LOCUS       X64423                   234 bp    mRNA    linear   PLN 07-MAR-1997
DEFINITION  N.tabacum mitochondrial F0-ATPase subunit 9 edited mRNA.
ACCESSION   X64423
VERSION     X64423.1
KEYWORDS    atp9 gene; ATPase subunit 9; Fo ATPase; proton-translocating
            ATPase; RNA editing.
SOURCE      mitochondrion Nicotiana tabacum (common tobacco)
  ORGANISM  Nicotiana tabacum
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; asterids; lamiids; Solanales; Solanaceae;
            Nicotianoideae; Nicotianeae; Nicotiana.
REFERENCE   1  (bases 1 to 234)
  AUTHORS   Hernould M., Mouras A., Litvak S., Araya A.
  TITLE     RNA editing of the mitochondrial atp9 transcript from tobacco
  JOURNAL   Nucleic Acids Res. 20(7), 1809-1809(1992).
   PUBMED   1533714
REFERENCE   2  (bases 1 to 234)
  AUTHORS   Hernould M.
  JOURNAL   Submitted (07-FEB-1992) to the INSDC. M. Hernould, IBCN/CNRS, 1 rue
            Camille Saint-Saens, 33077, Bordeaux Cedex, FRANCE
COMMENT     RNA editing replacements indicates original genomic bases.
            RNA editing alters the coding region in relation to the genomic
            coding region.
FEATURES             Location/Qualifiers
     source          1..234
                     /organism="Nicotiana tabacum"
                     /organelle="mitochondrion"
                     /strain="SR1"
                     /sub_strain="petit Havana"
                     /mol_type="mRNA"
                     /tissue_type="leaf"
                     /db_xref="taxon:4097"
     CDS             1..225
                     /gene="atp9"
                     /product="ATPase subunit 9"
                     /function="component of Fo-ATPase of inner membrane proton
                     channel"
                     /db_xref="GOA:P60116"
                     /db_xref="InterPro:IPR000454"
                     /db_xref="InterPro:IPR002379"
                     /db_xref="InterPro:IPR020537"
                     /db_xref="InterPro:IPR035921"
                     /db_xref="InterPro:IPR038662"
                     /db_xref="UniProtKB/Swiss-Prot:P60116"
                     /protein_id="CAA45770.1"
                     /translation="MLEGAKLMGAGAATIALAGAAIGIGNVFSSLIHSVARNPSLAKQ
                     LFGYAILGFALTEAIALFALMMAFLILFVF"
     misc_feature    20
                     /note="RNA editing site"
     misc_feature    20
                     /note="C to U RNA editing"
     misc_feature    50
                     /note="RNA editing site"
     misc_feature    50
                     /note="C to U RNA editing"
     misc_feature    81..82
                     /note="RNA editing site"
     misc_feature    81..82
                     /note="CC to UU RNA editing"
     misc_feature    90
                     /note="RNA editing site"
     misc_feature    90
                     /note="C to U RNA editing"
     misc_feature    92
                     /note="RNA editing site"
     misc_feature    92
                     /note="C to U RNA editing"
     misc_feature    182
                     /note="RNA editing site"
     misc_feature    182
                     /note="C to U RNA editing"
     misc_feature    191
                     /note="RNA editing site"
     misc_feature    191
                     /note="C to U RNA editing"
     misc_feature    212
                     /note="RNA editing site"
     misc_feature    212
                     /note="C to U RNA editing"
     misc_feature    223
                     /note="RNA editing site"
     misc_feature    223
                     /note="C to U RNA editing"
                     /note="Creates stop codon TAA"
     misc_feature    232..234
                     /note="stop codon in un-edited genomic sequence"
BASE COUNT           54 a           41 c           54 g           85 t
ORIGIN      
        1 atgttagaag gtgcaaaatt aatgggtgca ggagctgcta caattgcttt agcgggagct
       61 gctatcggta ttggaaacgt ttttagttct ttgattcatt ccgtggcgcg aaatccatca
      121 ttggcaaaac aattatttgg ttatgccatt ttgggctttg ctctaaccga agctattgca
      181 ttgtttgccc taatgatggc ctttttgatc ttattcgtat tctaagtccg ttag
//