LOCUS       X63709                   348 bp    RNA     linear   VRL 01-FEB-1997
DEFINITION  Mumps virus (BELFAST) SH gene sequence.
ACCESSION   X63709
VERSION     X63709.1
KEYWORDS    SH gene.
SOURCE      Mumps rubulavirus
  ORGANISM  Mumps rubulavirus
            Viruses; Riboviria; Negarnaviricota; Haploviricotina;
            Monjiviricetes; Mononegavirales; Paramyxoviridae; Rubulavirus.
REFERENCE   1  (bases 1 to 348)
  AUTHORS   Rima B.K.
  JOURNAL   Submitted (28-JAN-1992) to the INSDC. B.K. Rima, The Queen's Univ
            of Belfast, Med Biology Centre, 97 Lisburn Road, Belfast BT9  7 BL,
            Uk
REFERENCE   3  (bases 1 to 348)
  AUTHORS   Yeo R.P., Afzal M.A., Forsey T., Rima B.K.
  TITLE     Identification of a new mumps virus lineage by nucleotide sequence
            analysis of the SH gene of ten different strains
  JOURNAL   Arch. Virol. 128(3-4), 371-377(1993).
   PUBMED   8435047
FEATURES             Location/Qualifiers
     source          1..348
                     /organism="Mumps rubulavirus"
                     /strain="Belfast"
                     /mol_type="genomic RNA"
                     /db_xref="taxon:1979165"
     prim_transcript <1..22
                     /gene="F gene"
     misc_feature    23..30
                     /note="F-SH intergenic region"
     prim_transcript 31..346
                     /gene="SH gene"
     CDS             81..254
                     /gene="SH gene"
                     /db_xref="GOA:P28082"
                     /db_xref="InterPro:IPR001477"
                     /db_xref="UniProtKB/Swiss-Prot:P28082"
                     /protein_id="CAA45242.1"
                     /translation="MPAIQPPLYLTFLLLILLYRIITLYVWVVSTITYKTAVRHAALY
                     QRSLFRWSFDHSL"
     misc_feature    347..>348
                     /note="SH-HN intergenic region"
BASE COUNT          106 a           81 c           65 g           96 t
ORIGIN      
        1 ttaggaaaag atttagaaaa aacctaaatt aagaatgaat ctcccggggt cgtaacgtct
       61 cgtgaccctg ccgttgcact atgccggcga tccaacctcc cttataccta acatttctat
      121 tactaattct actctatcga atcataactt tgtatgtctg ggtcgtatca accattactt
      181 ataagacggc ggtgcgacat gcagcactgt accagagatc cttatttcgc tggagtttcg
      241 atcactcact ctagaaagat ctccagttag gacgagtccc agtccatcat gagtgaacaa
      301 gttgcattta aatgatgccg ttcaatcatg agacataaag aaaaaagc
//