LOCUS       X62852                   813 bp    mRNA    linear   HUM 14-NOV-2006
DEFINITION  H.sapiens ash mRNA.
ACCESSION   X62852
VERSION     X62852.1
KEYWORDS    ash gene; SH2 domain; SH3 domain; src homology-containing protein.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1
  AUTHORS   Matuoka K.
  JOURNAL   Submitted (28-OCT-1991) to the INSDC. K. Matuoka, Tokyo
            Metropolitan Inst. of Gerontology, Sakae-cho 35-2, Itabashi-ku,
            Tokyo 173, JAPAN
  REMARK    revised by [3]
REFERENCE   2  (bases 1 to 813)
  AUTHORS   Matuoka K., Shibata M., Yamakawa A., Takenawa T.
  TITLE     Cloning of ASH, a ubiquitous protein composed of one Src homology
            region (SH) 2 and two SH3 domains, from human and rat cDNA
            libraries
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 89(19), 9015-9019(1992).
   PUBMED   1384039
REFERENCE   3  (bases 1 to 813)
  AUTHORS   Matuoka K.
  JOURNAL   Submitted (22-OCT-1992) to the INSDC.
FEATURES             Location/Qualifiers
     source          1..813
                     /db_xref="H-InvDB:HIT000322545"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /dev_stage="fetus"
                     /cell_line="TIG-1"
                     /cell_type="fibroblast"
                     /tissue_type="lung"
                     /db_xref="taxon:9606"
     CDS             <1..483
                     /codon_start=1
                     /gene="ash"
                     /product="ash protein"
                     /note="3'region"
                     /note="Comparison with rat Ash cDNA sequence (accession
                     number X62853) suggests a lack of N-terminal coding region
                     in this sequence."
                     /db_xref="GOA:P62993"
                     /db_xref="H-InvDB:HIT000322545.13"
                     /db_xref="HGNC:HGNC:4566"
                     /db_xref="InterPro:IPR000980"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR030219"
                     /db_xref="InterPro:IPR035641"
                     /db_xref="InterPro:IPR035643"
                     /db_xref="InterPro:IPR036028"
                     /db_xref="InterPro:IPR036860"
                     /db_xref="PDB:1AZE"
                     /db_xref="PDB:1BM2"
                     /db_xref="PDB:1BMB"
                     /db_xref="PDB:1CJ1"
                     /db_xref="PDB:1FHS"
                     /db_xref="PDB:1FYR"
                     /db_xref="PDB:1GCQ"
                     /db_xref="PDB:1GFC"
                     /db_xref="PDB:1GFD"
                     /db_xref="PDB:1GHU"
                     /db_xref="PDB:1GRI"
                     /db_xref="PDB:1IO6"
                     /db_xref="PDB:1JYQ"
                     /db_xref="PDB:1JYR"
                     /db_xref="PDB:1JYU"
                     /db_xref="PDB:1QG1"
                     /db_xref="PDB:1TZE"
                     /db_xref="PDB:1X0N"
                     /db_xref="PDB:1ZFP"
                     /db_xref="PDB:2AOA"
                     /db_xref="PDB:2AOB"
                     /db_xref="PDB:2H46"
                     /db_xref="PDB:2H5K"
                     /db_xref="PDB:2HUW"
                     /db_xref="PDB:2VVK"
                     /db_xref="PDB:2VWF"
                     /db_xref="PDB:2W0Z"
                     /db_xref="PDB:3C7I"
                     /db_xref="PDB:3IMD"
                     /db_xref="PDB:3IMJ"
                     /db_xref="PDB:3IN7"
                     /db_xref="PDB:3IN8"
                     /db_xref="PDB:3KFJ"
                     /db_xref="PDB:3MXC"
                     /db_xref="PDB:3MXY"
                     /db_xref="PDB:3N7Y"
                     /db_xref="PDB:3N84"
                     /db_xref="PDB:3N8M"
                     /db_xref="PDB:3OV1"
                     /db_xref="PDB:3OVE"
                     /db_xref="PDB:3S8L"
                     /db_xref="PDB:3S8N"
                     /db_xref="PDB:3S8O"
                     /db_xref="PDB:3WA4"
                     /db_xref="PDB:4P9V"
                     /db_xref="PDB:4P9Z"
                     /db_xref="PDB:5CDW"
                     /db_xref="PDB:6ICG"
                     /db_xref="PDB:6ICH"
                     /db_xref="UniProtKB/Swiss-Prot:P62993"
                     /protein_id="CAA44664.1"
                     /translation="HPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKF
                     GNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPT
                     YVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNRNV
                     "
     mRNA            1..813
                     /partial
                     /gene="ash"
                     /note="3'region"
     misc_feature    <1..483
                     /note="encoding an identical amino acid sequence (E. J.
                     Lowenstein et al,Cell,Vol. 70,pp431-442, 1992)"
     misc_feature    <1..483
                     /note="a mammalian homologue of the C. elegans gene
                     product Sem-5 (S. G. Clark et al,Nature,Vol. 356,pp34"
     misc_feature    7..234
                     /product="SH2 domain"
     misc_feature    310..462
                     /product="SH3 domain"
     old_sequence    546
                     /replace="g"
                     /citation=[1]
     polyA_site      813
BASE COUNT          205 a          200 c          199 g          209 t
ORIGIN      
        1 catccgtggt tttttggcaa aatccccaga gccaaggcag aagaaatgct tagcaaacag
       61 cggcacgatg gggcctttct tatccgagag agtgagagcg ctcctgggga cttctccctc
      121 tctgtcaagt ttggaaacga tgtgcagcac ttcaaggtgc tccgagatgg agccgggaag
      181 tacttcctct gggtggtgaa gttcaattct ttgaatgagc tggtggatta tcacagatct
      241 acatctgtct ccagaaacca gcagatattc ctgcgggaca tagaacaggt gccacagcag
      301 ccgacatacg tccaggccct ctttgacttt gatccccagg aggatggaga gctgggcttc
      361 cgccggggag attttatcca tgtcatggat aactcagacc ccaactggtg gaaaggagct
      421 tgccacgggc agaccggcat gtttccccgc aattatgtca cccccgtgaa ccggaacgtc
      481 taagagtcaa gaagcaatta tttaaagaaa gtgaaaatgt aaacacatac aaagaattaa
      541 acccacaagc tgcctctgac agcagcctgt gagggagtgc agaacacctg gccgggtcac
      601 cctgtgaccc tctcactttg gttggaactt tagggggtgg gagggggcgt tggatttaaa
      661 aatgccaaaa cttacctata aattaagaag agtttttatt acaaattttc actgctgctc
      721 ctctttcccc tcctttgtct tttttttcat ccttttttct cttctgtcca tcagtgcatg
      781 acgtttaagg ccacgtatag tcctgctgac gcc
//