LOCUS       X16419                   485 bp    DNA     linear   BCT 24-MAY-1995
DEFINITION  E. coli DNA for cdd-promoter (ccd-P) and cdd gene fragment.
ACCESSION   X16419
VERSION     X16419.1
KEYWORDS    cdd gene; promoter.
SOURCE      Escherichia coli
  ORGANISM  Escherichia coli
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
            Enterobacteriaceae; Escherichia.
REFERENCE   1  (bases 1 to 485)
  AUTHORS   Holst B.
  JOURNAL   Submitted (04-SEP-1989) to the INSDC. Holst B., Department of
            Molecular Biology, University of Odense, Campsuvej 55, DK-5230
            Odense M, Denmark.
REFERENCE   2  (bases 1 to 485)
  AUTHORS   Valentin-Hansen P., Holst B., Josephsen J., Hammer K.,
            Albrechtsen B.
  TITLE     CRP/cAMP- and CytR-regulated promoters in Escherichia coli K12: the
            cdd promoter
  JOURNAL   Mol. Microbiol. 3(10), 1385-1390(1989).
   PUBMED   2575702
REFERENCE   3  (bases 1 to 485)
  AUTHORS   Holst B., Sogaard-Andersen L., Pedersen H., Valentin-Hansen P.
  TITLE     The cAMP-CRP/CytR nucleoprotein complex in Escherichia coli: two
            pairs of closely linked binding sites for the cAMP-CRP activator
            complex are involved in combinatorial regulation of the cdd
            promoter
  JOURNAL   EMBO J. 11(10), 3635-3643(1992).
   PUBMED   1327747
FEATURES             Location/Qualifiers
     source          1..485
                     /organism="Escherichia coli"
                     /map="47 min."
                     /strain="K12"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:562"
     misc_feature    125..145
                     /note="cAMP/CRP complex binding site"
     misc_feature    175..195
                     /note="cAMP/CRP complex binding site"
     regulatory      216..222
                     /note="pot. -10 region"
                     /regulatory_class="promoter"
     mRNA            228..>485
                     /note="exon 1"
     precursor_RNA   228..>485
                     /note="primary transcript"
     CDS             299..>485
                     /transl_table=11
                     /note="cdd gene product (AA 1 - 62) (485 is 1st base in
                     codon)"
                     /db_xref="GOA:P0ABF6"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="InterPro:IPR006263"
                     /db_xref="InterPro:IPR013171"
                     /db_xref="InterPro:IPR016192"
                     /db_xref="InterPro:IPR016193"
                     /db_xref="InterPro:IPR020797"
                     /db_xref="PDB:1AF2"
                     /db_xref="PDB:1ALN"
                     /db_xref="PDB:1CTT"
                     /db_xref="PDB:1CTU"
                     /db_xref="UniProtKB/Swiss-Prot:P0ABF6"
                     /protein_id="CAA34441.1"
                     /translation="MQSALEPILADKYFPALLTGEQVSSLKSATGLDEDALAFALLRW
                     RRPVRVRHCRILMLAQLR"
BASE COUNT          107 a          119 c          124 g          135 t
ORIGIN      
        1 gcgctgcgcc gagctggatt atcaggaagg tgcatttagt tcgctagcgc tggtgttatg
       61 cgggataatt acttcgctga tcgcaccgtt ccttttcccg attattctgg cagtaatggg
      121 ctaaaatttg cgatgcgtcg cgcatttttg atgtatgttt cacgcgttgc ataattaatg
      181 agattcagat cacatataaa gccacaacgg gttcgtaaac tgttatccca ttacatgatt
      241 atgaggcaac gccatgcatc cacgttttca aaccgctttt gcccaacttg cggataactt
      301 gcaatctgca ctggaaccta ttctggcaga caagtacttc cccgctttgt tgaccgggga
      361 gcaagtctca tcgctgaaga gcgcaacggg gctggacgaa gacgcgctgg cattcgcact
      421 acttcgctgg cggcggcctg tgcgcgtacg ccattgtcga attttaatgt tggcgcaatt
      481 gcgcg
//