LOCUS       X03474                   574 bp    DNA     linear   BCT 23-OCT-2008
DEFINITION  E. coli left end of transposon Tn7 inserted into glmS terminator.
ACCESSION   X03474 M24254-M24255
VERSION     X03474.1
KEYWORDS    glmS gene; glutamine amidotransferase; terminator; transferase;
            transposon; unidentified reading frame.
SOURCE      Escherichia coli
  ORGANISM  Escherichia coli
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
            Enterobacteriaceae; Escherichia.
REFERENCE   1  (bases 1 to 574)
  AUTHORS   Gay N.J., Tybulewicz V.L.J., Walker J.E.
  TITLE     Insertion of transposon Tn7 into the Escherichia coli glmS
            transcriptional terminator
  JOURNAL   Biochem. J. 234(1), 111-117(1986).
   PUBMED   3010949
COMMENT     see also V00620
            Transposition of Tn7 into E. coli glmS transcriptional
            terminator abolishes transcription termination at this site; the
            transcript now extends into the left end of Tn7 and terminates at a
            new site "tm", 127 base pairs from the left end of Tn7. This region
            of the transposon contains a long open reading frame which encodes
            a protein sequence that is significantly related to the transposase
            proteins of the transposable elements IS1 and Tn3.
FEATURES             Location/Qualifiers
     source          1..574
                     /organism="Escherichia coli"
                     /strain="GD92::Tn7."
                     /mol_type="genomic DNA"
                     /db_xref="taxon:562"
     CDS             <1..12
                     /codon_start=1
                     /transl_table=11
                     /gene="glmS"
                     /product="glutamine amidotransferase"
                     /protein_id="CAA27191.1"
                     /translation="TVE"
     misc_feature    17..37
                     /note="transcription terminator fragment (glmS)"
     repeat_region   17..28
                     /note="imp. inverted repeat A"
     repeat_region   33..37
                     /note="interrupted imp. inverted repeat A'"
     mobile_element  38..574
                     /mobile_element_type="transposon:Tn7"
     regulatory      117..123
                     /note="put. -35 region (Tn7)"
                     /regulatory_class="promoter"
     regulatory      140..145
                     /note="put. -10 region (Tn7)"
                     /regulatory_class="promoter"
     misc_feature    148
                     /note="put. transcription initiation site (Tn7)"
     regulatory      164
                     /note="put. new transcription termination site, tm site
                     (glmS)"
                     /regulatory_class="other"
     CDS             172..>574
                     /transl_table=11
                     /product="Tn7 URF1"
                     /db_xref="GOA:P13988"
                     /db_xref="InterPro:IPR011335"
                     /db_xref="InterPro:IPR011856"
                     /db_xref="InterPro:IPR014832"
                     /db_xref="InterPro:IPR014833"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="InterPro:IPR036390"
                     /db_xref="PDB:1F1Z"
                     /db_xref="PDB:1T0F"
                     /db_xref="UniProtKB/Swiss-Prot:P13988"
                     /protein_id="CAA27192.1"
                     /translation="MAKANSSFSEVQIARRIKEGRGQGHGKDYIPWLTVQEVPSSGRS
                     HRIYSHKTGRVHHLLSDLELAVFLSLEWESSVLDIREQFPLLPSDTRQIAIDSGIKHP
                     VIRGVDQVMSTDFLVDCKDGPFEQFAIQVKPA"
BASE COUNT          165 a          105 c          133 g          171 t
ORIGIN      
        1 acggttgagt aataaatgga tgccctgcgt aagcgggtgt gggcggacaa taaagtctta
       61 aactgaacaa aatagatcta aactatgaca ataaagtctt aaactagaca gaatagttgt
      121 aaactgaaat cagtccagtt atgctgtgaa aaagcatact ggacttttgt tatggctaaa
      181 gcaaactctt cattttctga agtgcaaatt gcccgtcgta ttaaagaggg gcgtggccaa
      241 gggcatggta aagactatat tccatggcta acagtacaag aagttccttc ttcaggtcgt
      301 tcccaccgta tttattctca taagacggga cgagtccatc atttgctatc tgacttagag
      361 cttgctgttt ttctcagtct tgagtgggag agcagcgtgc tagatatacg cgagcagttc
      421 cccttattac ctagtgatac caggcagatt gcaatagata gtggtattaa gcatcctgtt
      481 attcgtggtg tagatcaggt tatgtctact gattttttag tggactgcaa agatggtcct
      541 tttgagcagt ttgctattca agtcaaacct gcag
//