LOCUS       X02143                  1319 bp    DNA     linear   BCT 23-OCT-2008
DEFINITION  Escherichia coli K-12 pldA gene for DR-phospholipase A.
ACCESSION   X02143 X00780
VERSION     X02143.1
KEYWORDS    inverted repeat; phospholipase; signal peptide.
SOURCE      Escherichia coli
  ORGANISM  Escherichia coli
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
            Enterobacteriaceae; Escherichia.
REFERENCE   1  (bases 1 to 1319)
  AUTHORS   Homma H., Kobayashi T., Chiba N., Karasawa K., Mizushima H.,
            Kudo I., Inoue K., Ikeda H., Sekiguchi M., Nojima S.
  TITLE     The DNA sequence encoding pldA gene, the structural gene for
            detergent-resistant phospholipase A of E. coli
  JOURNAL   J. Biochem. 96(6), 1655-1664(1984).
   PUBMED   6397464
REFERENCE   2  (bases 87 to 1288)
  AUTHORS   de Geus P., Verheij H.M., Riegman N.H., Hoekstra W.P.M.,
            de Haas G.H.
  TITLE     The pro- and mature forms of the E. coli K-12 outer membrane
            phospholipase A are identical
  JOURNAL   EMBO J. 3(8), 1799-1802(1984).
   PUBMED   6383820
COMMENT     Data kindly reviewed (30-JAN-1986) by I. Kudo
FEATURES             Location/Qualifiers
     source          1..1319
                     /organism="Escherichia coli"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:562"
     regulatory      121..127
                     /note="pot. -35 region (a)"
                     /regulatory_class="promoter"
     regulatory      148..153
                     /note="pot. -10 region (a)"
                     /regulatory_class="promoter"
     regulatory      160..165
                     /note="pot. -35 region (b)"
                     /regulatory_class="promoter"
     regulatory      188..193
                     /note="pot. -10 region (b)"
                     /regulatory_class="promoter"
     regulatory      204..209
                     /note="pot. -35 region (c)"
                     /regulatory_class="promoter"
     misc_feature    213..241
                     /note="pot. hairpin structure"
     repeat_region   213..217
                     /note="inverted repeat A"
     regulatory      232..237
                     /note="pot. -10 region (c)"
                     /regulatory_class="promoter"
     repeat_region   237..241
                     /note="inverted repeat A'"
     regulatory      275..281
                     /note="put. Shine-Dalgarno sequence"
                     /regulatory_class="ribosome_binding_site"
     CDS             292..1161
                     /transl_table=11
                     /product="DR phospholipase A"
                     /db_xref="GOA:P0A921"
                     /db_xref="InterPro:IPR003187"
                     /db_xref="InterPro:IPR036541"
                     /db_xref="PDB:1FW2"
                     /db_xref="PDB:1FW3"
                     /db_xref="PDB:1ILD"
                     /db_xref="PDB:1ILZ"
                     /db_xref="PDB:1IM0"
                     /db_xref="PDB:1QD5"
                     /db_xref="PDB:1QD6"
                     /db_xref="UniProtKB/Swiss-Prot:P0A921"
                     /protein_id="CAA26081.1"
                     /translation="MRTLQGWLLPVFMLPMAVYAQEATVKEVHDAPAVRGSIIANMLQ
                     EHDNPFTLYPYDTNYLIYTQTSDLNKEAIASYDWAENARKDEVKFQLSLAFPLWRGIL
                     GPNSVLGASYTQKSWWQLSNSEESSPFRETNYEPQLFLGFATDYRFAGWTLRDVEMGY
                     NHDSNGRSDPTSRSWNRLYTRLMAENGNWLVEVKPWYVVGNTDDNPDITKYMGYYQLK
                     IGYHLGDAVLSAKGQYNWNTGYGGAELGLSYPITKHVRLYTQVYSGYGESLIDYNFNQ
                     TRVGVGVMLNDLF"
     sig_peptide     292..351
                     /note="signal peptide (aa -20 to -1)"
     mat_peptide     352..1158
                     /note="DR phospholipase A (aa 1-269)"
     misc_feature    903..932
                     /note="pot. hairpin structure"
     repeat_region   903..908
                     /note="inverted repeat B"
     repeat_region   927..932
                     /note="inverted repeat B'"
     regulatory      1245..1266
                     /note="pot. transcription terminator"
                     /regulatory_class="other"
     repeat_region   1245..1252
                     /note="inverted repeat C"
     repeat_region   1259..1266
                     /note="inverted repeat C'"
     misc_feature    1267..1275
                     /note="T-rich stretch"
BASE COUNT          334 a          303 c          341 g          341 t
ORIGIN      
        1 ccagctgtgc gaactctttt tcgtaacgct ccagttccat ccccaatgcg cggttaaatg
       61 gcatgtgata aacaaacatc tcacccacta atttcagggc ttgttcagcg gtcagtacgg
      121 cagacatatc atccttacac ttcattggtt aatgaaatgt tgattttatg cttctttgtt
      181 gttggtttct actttaggaa gggataacta acggctatgg agttaagtat gtaaaatagc
      241 ccgcagaaaa atattcacct tatcaataat tcgttacgga gaacacgacc gatgcggact
      301 ctgcagggct ggttgttgcc ggtgtttatg ttgcctatgg cagtatatgc acaagaggca
      361 acggtgaaag aggtgcatga cgcgccagcg gtgcgtggca gtattatcgc caatatgctg
      421 caggagcatg acaatccgtt cacgctctat ccttatgaca ccaactacct catttacacc
      481 caaaccagcg atctgaataa agaagcgatt gccagttacg actgggcgga aaatgcgcgt
      541 aaggatgaag taaagtttca gttgagcctg gcatttccgc tgtggcgtgg gattttaggc
      601 ccgaactcgg tgttgggtgc gtcttatacg caaaaatcct ggtggcaact gtccaatagc
      661 gaagagtctt caccgtttcg tgaaaccaac tacgaaccgc aattgttcct cggttttgcc
      721 accgattacc gttttgcagg ttggacgctg cgcgatgtgg agatggggta taaccacgac
      781 tctaacgggc gttccgaccc gacctcccgc agctggaacc gcctttatac tcgcctgatg
      841 gcagaaaacg gtaactggct ggtagaagtg aagccgtggt atgtggtggg taatactgac
      901 gataacccgg atatcaccaa atatatgggt tactaccagc ttaaaatcgg ctatcacctc
      961 ggtgatgcgg tgctcagtgc gaaaggacag tacaactgga acaccggcta cggcggcgcg
     1021 gagttaggct taagttaccc gatcaccaaa catgtgcgcc tttatactca ggtttacagc
     1081 ggctatggcg aatcgctcat cgactataac ttcaaccaga cccgtgtcgg tgtgggggtt
     1141 atgctaaacg atttgttttg atgaacggtt gagtggttgg caaatctgga atccagcatc
     1201 caggattacc ctctcagaga ctaaaagcat tgcagtttct cgcgcaggcg ctgaaaatag
     1261 cgcctgtttt tatttcaggc aatcggggtg aatgtggcgc aggcggaagt gttgaatct
//