LOCUS       X00955                   467 bp    mRNA    linear   HUM 07-OCT-2008
DEFINITION  Human mRNA for apolipoprotein AII precursor.
ACCESSION   X00955 K01686 K02216 X00569 X00927
VERSION     X00955.1
KEYWORDS    apolipoprotein; signal peptide.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 467)
  AUTHORS   Knott T.J., Priestley L.M., Urdea M.S., Scott J.
  TITLE     Isolation and characterisation of a cDNA encoding the precursor for
            human apolipoprotein AII
  JOURNAL   Biochem. Biophys. Res. Commun. 120(3), 734-740(1984).
   PUBMED   6428397
REFERENCE   2
  AUTHORS   Brewer H.M., Lux S.E., Ronan R., John K.M.
  TITLE     Amino acid sequence of human apoLp-Gln-II (apoA-II), an
            apolipoprotein isolated from the high-density lipoprotein complex
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 69(5), 1304-1308(1972).
   PUBMED   4338591
REFERENCE   3
  AUTHORS   Lackner K.J., Law S.W., Brewer H.B.Jr.
  TITLE     Human apolipoprotein A-II: complete nucleic acid sequence of
            preproapo A-II
  JOURNAL   FEBS Lett. 175(1), 159-164(1984).
   PUBMED   6090207
REFERENCE   4
  AUTHORS   Moore M.N., Kao F.T., Tsao Y.K., Chan L.
  TITLE     Human apolipoprotein A-II: nucleotide sequence of a cloned cDNA,
            and localization of its structural gene on human chromosome 1
  JOURNAL   Biochem. Biophys. Res. Commun. 123(1), 1-7(1984).
   PUBMED   6089788
REFERENCE   5
  AUTHORS   Sharpe C.R., Sidoli A., Shelley C.S., Lucero M.A., Shoulders C.C.,
            Baralle F.E.
  TITLE     Human apolipoproteins AI, AII, CII and CIII. cDNA sequences and
            mRNA abundance
  JOURNAL   Nucleic Acids Res. 12(9), 3917-3932(1984).
   PUBMED   6328445
FEATURES             Location/Qualifiers
     source          1..467
                     /db_xref="H-InvDB:HIT000320883"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     CDS             52..354
                     /note="prepro-apo AII"
                     /db_xref="GOA:P02652"
                     /db_xref="H-InvDB:HIT000320883.13"
                     /db_xref="HGNC:HGNC:601"
                     /db_xref="InterPro:IPR006801"
                     /db_xref="InterPro:IPR036172"
                     /db_xref="UniProtKB/Swiss-Prot:P02652"
                     /protein_id="CAA25467.1"
                     /translation="MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDY
                     GKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ"
     sig_peptide     52..105
                     /note="signal peptide"
     misc_feature    105..106
                     /note="signal peptidase cleavage site"
     misc_feature    106..120
                     /note="propeptide"
     mat_peptide     121..351
                     /note="apo AII"
     misc_feature    448..453
                     /note="polyadenylation signal"
     polyA_site      467..467
                     /note="polyadenylation site"
BASE COUNT          119 a          133 c          114 g          101 t
ORIGIN      
        1 atacccgagg acagagatgt tggttaggcc gccctcccca ctgttaccaa catgaagctg
       61 ctcgcagcaa ctgtgctact cctcaccatc tgcagccttg aaggagcttt ggttcggaga
      121 caggcaaagg agccatgtgt ggagagcctg gtttctcagt acttccagac cgtgactgac
      181 tatggcaagg acctgatgga gaaggtcaag agcccagagc ttcaggccga ggccaagtct
      241 tactttgaaa agtcaaagga gcagctgaca cccctgatca agaaggctgg aacggaactg
      301 gttaacttct tgagctattt cgtggaactt ggaacacagc ctgccaccca gtgaagtgtc
      361 cagcaccatt gtcttccaac cccagctggc ctctagaaca cccactggcc agtcctagag
      421 ctcctgtccc tacccactct ttgctacaat aaatgctgaa tgaatcc
//