LOCUS       VBNE01000150             604 bp    DNA     linear   ENV 28-MAY-2019
DEFINITION  Gammaproteobacteria bacterium isolate GP_13
            14_1009_12_20cm_scaffold_7722_e:6670, whole genome shotgun
            sequence.
ACCESSION   VBNE01000150 VBNE01000000
VERSION     VBNE01000150.1
DBLINK      BioProject: PRJNA449266
            BioSample: SAMN11380622
KEYWORDS    WGS.
SOURCE      Gammaproteobacteria bacterium (soil metagenome)
  ORGANISM  Gammaproteobacteria bacterium
            Bacteria; Proteobacteria; Gammaproteobacteria.
REFERENCE   1  (bases 1 to 604)
  AUTHORS   Diamond,S., Andeer,P.F., Li,Z., Crits-Christoph,A., Burstein,D.,
            Anantharaman,K., Lane,K.R., Thomas,B.C., Pan,C., Northen,T.R. and
            Banfield,J.F.
  TITLE     Mediterranean grassland soil C-N compound turnover is dependent on
            rainfall and depth, and is mediated by genomically divergent
            microorganisms
  JOURNAL   Nat Microbiol (2019) In press
   PUBMED   31110364
  REMARK    Publication Status: Available-Online prior to print
REFERENCE   2  (bases 1 to 604)
  AUTHORS   Diamond,S. and Banfield,J.F.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-MAY-2019) Earth and Planetary Science, Jill
            Banfield's Lab at Berkeley, University of California, Berkeley, CA
            94720, USA
COMMENT     The annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (PGAP). Information about PGAP can be found here:
            https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Assembly-Data-START##
            Assembly Method        :: IDBA_UD v. 1.1.1
            Genome Representation  :: Full
            Expected Final Version :: Yes
            Genome Coverage        :: 17x
            Sequencing Technology  :: Illumina HiSeq
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider               :: NCBI
            Annotation Date                   :: 05/16/2019 13:12:02
            Annotation Pipeline               :: NCBI Prokaryotic Genome
                                                 Annotation Pipeline (PGAP)
            Annotation Method                 :: Best-placed reference protein
                                                 set; GeneMarkS-2+
            Annotation Software revision      :: 4.8
            Features Annotated                :: Gene; CDS; rRNA; tRNA; ncRNA;
                                                 repeat_region
            Genes (total)                     :: 4,034
            CDSs (total)                      :: 3,993
            Genes (coding)                    :: 3,887
            CDSs (with protein)               :: 3,887
            Genes (RNA)                       :: 41
            rRNAs                             :: 1 (16S)
            partial rRNAs                     :: 1 (16S)
            tRNAs                             :: 36
            ncRNAs                            :: 4
            Pseudo Genes (total)              :: 106
            CDSs (without protein)            :: 106
            Pseudo Genes (ambiguous residues) :: 21 of 106
            Pseudo Genes (frameshifted)       :: 43 of 106
            Pseudo Genes (incomplete)         :: 51 of 106
            Pseudo Genes (internal stop)      :: 3 of 106
            Pseudo Genes (multiple problems)  :: 12 of 106
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..604
                     /organism="Gammaproteobacteria bacterium"
                     /mol_type="genomic DNA"
                     /isolate="GP_13"
                     /isolation_source="temperate grassland biome"
                     /db_xref="taxon:1913989"
                     /environmental_sample
                     /geo_loc_name="USA: Angelo Coast Range Reserve, CA"
                     /lat_lon="39.74 N 123.63 W"
                     /collection_date="2014-09-03"
                     /metagenome_source="soil metagenome"
                     /note="metagenomic"
     gene            76..>604
                     /locus_tag="E6K32_06155"
     CDS             76..>604
                     /locus_tag="E6K32_06155"
                     /inference="COORDINATES: protein motif:HMM:PF07969.9"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidohydrolase"
                     /protein_id="TLZ44028.1"
                     /translation="MMNRRPAPSEPCPWGLLALMFLSWAARVCSGAESIVLVSGNVYT
                     ADDRNSRAQAVVAAHGRILYVGANADALRRAPPGARRMDMHGLTILPGLTDSHAHLAG
                     IGFRELSFNLEGTASVADLKDRLRERAKQGTPGEWLTGRGWIESRWTPPTFPGRTDLD
                     EIASDRPVFLERADGH"
BASE COUNT          100 a          195 c          198 g          111 t
ORIGIN      
        1 accgctcgag ctacacttca ggctcgatca tttccggccc gtgcttaccg gagacgccgt
       61 cgccatggcg ttaagatgat gaatagacgg cctgcaccat ctgagccgtg cccatggggc
      121 ttactggccc tgatgtttct gtcctgggcg gctcgcgtct gcagcggtgc cgagtccatc
      181 gtgcttgtca gtggcaacgt gtatacggcc gatgaccgta actcacgcgc tcaggccgtc
      241 gtcgcagcgc acggtcgcat tctgtacgtc ggcgccaacg ccgatgcgtt gcgacgagcg
      301 ccaccaggcg cgcgccgtat ggatatgcac ggcctcacca tcctacccgg gcttacggac
      361 tcacacgccc acttggccgg tatcgggttc cgggagttga gcttcaatct ggaaggcacc
      421 gcgagcgttg cagacctgaa ggaccggctt cgcgagcgcg caaagcaggg gacgcccggc
      481 gagtggctca cggggcgagg atggatcgag tcgcgctgga cgcctccgac ctttccgggc
      541 cgcaccgacc tggatgagat cgccagcgat cggccggtgt ttctcgagcg tgcggacggg
      601 cacg
//