LOCUS       BAU44124                 836 bp    DNA     linear   VRL 08-OCT-1996
DEFINITION  Bovine adenovirus type 2 hexon protein (L3 II) gene, partial cds,
            endoprotease (L3 23K) gene, complete cds, and DNA-binding protein
            (E2a DBP) gene, partial cds.
ACCESSION   U44124
VERSION     U44124.1
KEYWORDS    .
SOURCE      Bovine adenovirus 2
  ORGANISM  Bovine adenovirus 2
            Viruses; Varidnaviria; Bamfordvirae; Preplasmiviricota;
            Tectiliviricetes; Rowavirales; Adenoviridae; Mastadenovirus; Ovine
            mastadenovirus A.
REFERENCE   1  (bases 1 to 836)
  AUTHORS   Harrach,B., Evans,P., Rusvai,M., Banrevi,A., Letchworth,G.J. and
            Benko,M.
  TITLE     Codon usage differences among the protease genes of the
            phylogenetically closely related bovine adenovirus type 1, 2 and 3
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 836)
  AUTHORS   Harrach,B.
  TITLE     Direct Submission
  JOURNAL   Submitted (31-DEC-1995) Balazs Harrach, Veterinary Medical Research
            Institute, Hungarian Academy of Sciences, Hungaria krt. 21.,
            Budapest H-1581, Hungary
FEATURES             Location/Qualifiers
     source          1..836
                     /organism="Bovine adenovirus 2"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:114429"
                     /clone="p201"
                     /note="appr. 59.8-62.3 %G"
     gene            1..77
                     /gene="L3 II"
     CDS             <1..77
                     /gene="L3 II"
                     /note="protein II; virion component II; major capsid
                     protein"
                     /codon_start=3
                     /product="hexon protein"
                     /protein_id="AAB16760.1"
                     /translation="HQPHRGVIETVYLRTPFSAGNATT"
     gene            88..706
                     /gene="L3 23K"
     CDS             88..705
                     /gene="L3 23K"
                     /function="proteolysis during virus maturation"
                     /note="proteinase; 23 kDa protein; protease; This cystein
                     protease cleaves the capsid proteins IIIa, pVI, pVII,
                     pVIII, pX, pTP, the scaffolding protein 52K, and the
                     cytoskeletal proteins cytokeratin K7 and K18"
                     /codon_start=1
                     /product="endoprotease"
                     /protein_id="AAB16761.1"
                     /translation="MGSREEELRAIVRDLGISPYFLGTFDKRFPGFLHKDKLSCAIVN
                     TAARETGGAHWLALAWFPNAKNFYFFDPFGFSDHKLKQIYQFEYEGLLRRSALAGDGC
                     VNLVKSTETVQGPNSAACGLFCCMFLHAFVNWPDRPMTRNPTMDLLTGVPNADMMKPS
                     SLAILRENQNQLYKFLSTHSQYFRTHRPQIERDTSFNKLLELKNQ"
     regulatory      701..706
                     /regulatory_class="polyA_signal_sequence"
                     /gene="L3 23K"
     gene            complement(713..836)
                     /gene="E2a DBP"
     regulatory      complement(713..718)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="E2a DBP"
     CDS             complement(744..>836)
                     /gene="E2a DBP"
                     /note="DBP; single-stranded DNA binding"
                     /codon_start=1
                     /product="DNA-binding protein"
                     /protein_id="AAB16762.1"
                     /translation="VVQEFKWQPQYRVQNTLLPTGQDDADECLF"
BASE COUNT          230 a          195 c          179 g          232 t
ORIGIN      
        1 tgcatcaacc acacaggggc gtcattgaaa ccgtgtacct gagaactccg ttctctgctg
       61 gcaacgccac tacataatcg ccgcgagatg ggctccaggg aagaagagtt gcgagctatt
      121 gttcgcgact taggcataag tccttacttt ttaggaactt ttgacaagcg cttcccaggt
      181 ttcttgcata aagataaact gagttgcgcg attgtcaata cagcggcccg cgagaccggt
      241 ggggcacact ggcttgccct agcttggttt ccaaacgcta aaaactttta ttttttcgac
      301 ccgtttgggt tttctgacca taaacttaaa caaatttatc agtttgaata tgaaggcttg
      361 ttgcgccgaa gcgcgctagc gggcgatggc tgcgtaaatt tagtaaaaag caccgaaaca
      421 gttcaaggac caaacagcgc cgcctgtggg ttattttgtt gcatgttttt acacgctttt
      481 gtaaattggc cagaccgccc aatgacacga aaccccacaa tggatttgct aactggcgtt
      541 cctaatgctg atatgatgaa accgtcgtcg cttgcaattt taagagaaaa ccaaaatcag
      601 ctgtataagt ttttgtcaac ccactcccaa tactttcgca ctcaccgccc ccaaattgaa
      661 cgcgatacct cttttaataa actgctagaa ctcaaaaatc aataaactaa actttattga
      721 acttttgcgt gtcagaattt tgtttaaaaa agacattcgt cagcatcatc ttggccggtg
      781 gggagaagag tattttggac tctgtattga ggttgccact tgaactcttg aaccac
//