LOCUS       ACU21335                 713 bp    mRNA    linear   VRT 26-OCT-1999
DEFINITION  Agkistrodon contortrix myotoxin precursor (ACLPREMT1) mRNA,
            complete cds.
ACCESSION   U21335
VERSION     U21335.1
KEYWORDS    .
SOURCE      Agkistrodon laticinctus (broad-banded copperhead)
  ORGANISM  Agkistrodon laticinctus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Lepidosauria; Squamata; Bifurcata; Unidentata; Episquamata;
            Toxicofera; Serpentes; Colubroidea; Viperidae; Crotalinae;
            Agkistrodon.
REFERENCE   1  (bases 1 to 713)
  AUTHORS   Johnson,E.K. and Ownby,C.L.
  TITLE     Isolation of a myotoxin from the venom of Agkistrodon contortrix
            laticinctus (broad-banded copperhead) and pathogenesis of
            myonecrosis induced by it in mice
  JOURNAL   Toxicon 31 (3), 243-255 (1993)
   PUBMED   8470130
REFERENCE   2  (bases 1 to 713)
  AUTHORS   Johnson,E.K. and Ownby,C.L.
  TITLE     The role of extracellular ions in the pathogenesis of myonecrosis
            induced by a myotoxin isolated from Broad-Banded Copperhead
            (Agkistrodon contortrix laticinctus) venom
  JOURNAL   Comp. Biochem. Physiol. 107 (C) (3), 359-366 (1994)
REFERENCE   3  (bases 1 to 713)
  AUTHORS   Selistre de Araujo,H.S., White,S.P. and Ownby,C.L.
  TITLE     cDNA cloning and sequence analysis of a lysine-49 phospholipase A2
            myotoxin from Agkistrodon contortrix laticinctus snake venom
  JOURNAL   Arch. Biochem. Biophys. 326 (1), 21-30 (1996)
   PUBMED   8579368
REFERENCE   4  (bases 1 to 713)
  AUTHORS   Selistre De Araujo,H.S.
  TITLE     Direct Submission
  JOURNAL   Submitted (22-FEB-1995) Heloisa Selistre De Araujo, Physiological
            Sciences, Oklahoma State University, 264 Veterinary Medicine,
            Stillwater, OK 74078-0350, USA
FEATURES             Location/Qualifiers
     source          1..713
                     /organism="Agkistrodon laticinctus"
                     /mol_type="mRNA"
                     /db_xref="taxon:2782196"
                     /clone="MT-1"
                     /tissue_type="venom gland"
                     /clone_lib="ZAP1-ACL made by Heloisa Selistre De Araujo et
                     al., Physiological Sciences, Oklahoma State University"
     gene            1..713
                     /gene="ACLPREMT1"
     5'UTR           1..189
                     /gene="ACLPREMT1"
                     /experiment="experimental evidence, no additional details
                     recorded"
     CDS             190..603
                     /gene="ACLPREMT1"
                     /function="induces necrosis of muscle cells"
                     /standard_name="Agkistrodon contortrix laticinctus
                     myotoxin 1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="ACLMT1; promyotoxin - precursor form of myotoxin,
                     lacks enzymatic activity"
                     /codon_start=1
                     /product="myotoxin precursor"
                     /protein_id="AAC59887.1"
                     /translation="MRTLWIVALLLVGVEGSLLELGKMILQETGKNAITSYGSYGCNC
                     GWGHRGQPKDATDRCCFVHKCCYKKLTDCNHKTDRYSYSWKNKAIICEEKNPCLKEMC
                     ECDKAVAICLRENLDTYNKKYKAYFKFKCKKPETC"
     sig_peptide     190..237
                     /gene="ACLPREMT1"
                     /experiment="experimental evidence, no additional details
                     recorded"
     mat_peptide     238..600
                     /gene="ACLPREMT1"
                     /product="myotoxin"
                     /function="induces necrosis of muscle cells"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="similar to phospholipase A2, Swiss-Prot Accession
                     Number P04361; devoid of enzymatic activity"
     3'UTR           604..712
                     /gene="ACLPREMT1"
                     /experiment="experimental evidence, no additional details
                     recorded"
     regulatory      684..689
                     /regulatory_class="polyA_signal_sequence"
                     /gene="ACLPREMT1"
                     /experiment="experimental evidence, no additional details
                     recorded"
     polyA_site      713
                     /gene="ACLPREMT1"
                     /experiment="experimental evidence, no additional details
                     recorded"
BASE COUNT          200 a          173 c          171 g          169 t
ORIGIN      
        1 ggcacgagct gccaggtgtg aatctttgcc attttcccct gcccggcttc tccttctgat
       61 ccttgcctac aggttatcct tgacttacaa ccgtttgttt agtgaccgtt ctaagagcca
      121 ttttccagac ttttcaccag cggaggcgat taacgggatc cgctcattcc caggtctgga
      181 ttcgggagga tgaggactct ctggatagtg gcactgttgc tggtgggcgt cgaggggagc
      241 ctgctcgaat tggggaagat gatcctgcaa gagacaggga aaaacgctat tacatcctac
      301 ggctcttatg gatgcaactg tggctggggg caccgaggcc agccaaaaga cgccactgac
      361 cgttgctgct tcgtgcacaa atgctgttac aaaaaactga ccgactgcaa ccacaaaaca
      421 gaccgctact cctatagctg gaaaaacaag gctatcatct gcgaagagaa aaacccgtgc
      481 ctgaaggaga tgtgtgagtg tgacaaggcc gtggcaatct gcctccgaga aaatctggac
      541 acgtacaaca aaaaatataa agcttacttt aaatttaaat gcaagaagcc agaaacgtgc
      601 taagtctctg caggctggga aaaaaccctc aaattacaca atcatagttg tgttactcta
      661 ttattctgaa tgcaatactg aataataaac aggtgccagc tttgcactcc aca
//