LOCUS       SUHJ01001689             357 bp    DNA     linear   ENV 30-APR-2019
DEFINITION  Mesorhizobium sp. isolate N.Ca.IN.011.15.1
            NODE_1712_length_357_cov_8.096026, whole genome shotgun sequence.
ACCESSION   SUHJ01001689 SUHJ01000000
VERSION     SUHJ01001689.1
DBLINK      BioProject: PRJNA453501
            BioSample: SAMN11348855
KEYWORDS    WGS.
SOURCE      Mesorhizobium sp. (plant metagenome)
  ORGANISM  Mesorhizobium sp.
            Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales;
            Phyllobacteriaceae; Mesorhizobium.
REFERENCE   1  (bases 1 to 357)
  AUTHORS   Greenlon,A., Chang,P.L. and Cook,D.R.
  TITLE     Global Population Genomics of Chickpea-Nodulating Mesorhizobium
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 357)
  AUTHORS   Greenlon,A., Chang,P.L. and Cook,D.R.
  TITLE     Direct Submission
  JOURNAL   Submitted (12-APR-2019) Plant Pathology, Cook Lab - University of
            California at Davis, One Shields Ave, Davis, CA 95616, USA
COMMENT     The annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (PGAP). Information about PGAP can be found here:
            https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Assembly-Data-START##
            Assembly Method        :: SPAdes v. 3.10.1
            Genome Representation  :: Full
            Expected Final Version :: Yes
            Genome Coverage        :: 34x
            Sequencing Technology  :: Illumina
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider               :: NCBI
            Annotation Date                   :: 04/25/2019 23:01:12
            Annotation Pipeline               :: NCBI Prokaryotic Genome
                                                 Annotation Pipeline (PGAP)
            Annotation Method                 :: Best-placed reference protein
                                                 set; GeneMarkS-2+
            Annotation Software revision      :: 4.8
            Features Annotated                :: Gene; CDS; rRNA; tRNA; ncRNA;
                                                 repeat_region
            Genes (total)                     :: 9,017
            CDSs (total)                      :: 8,959
            Genes (coding)                    :: 8,327
            CDSs (with protein)               :: 8,327
            Genes (RNA)                       :: 58
            rRNAs                             :: 1, 1, 2 (5S, 16S, 23S)
            complete rRNAs                    :: 1, 1 (5S, 16S)
            partial rRNAs                     :: 2 (23S)
            tRNAs                             :: 50
            ncRNAs                            :: 4
            Pseudo Genes (total)              :: 632
            CDSs (without protein)            :: 632
            Pseudo Genes (ambiguous residues) :: 275 of 632
            Pseudo Genes (frameshifted)       :: 236 of 632
            Pseudo Genes (incomplete)         :: 221 of 632
            Pseudo Genes (internal stop)      :: 51 of 632
            Pseudo Genes (multiple problems)  :: 140 of 632
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..357
                     /organism="Mesorhizobium sp."
                     /mol_type="genomic DNA"
                     /isolate="N.Ca.IN.011.15.1"
                     /isolation_source="root nodule"
                     /host="Cicer arietinum"
                     /db_xref="taxon:1871066"
                     /environmental_sample
                     /geo_loc_name="India: Bihar, Buxar, Buxar"
                     /lat_lon="25.5524166666667 N 83.9623888888889 E"
                     /collection_date="2016-01"
                     /collected_by="USAID Feed the Future Innovation Lab for
                     Climate Resilient Chickpea"
                     /metagenome_source="plant metagenome"
                     /note="metagenomic"
     gene            15..>357
                     /locus_tag="E5X77_42725"
     CDS             15..>357
                     /locus_tag="E5X77_42725"
                     /inference="COORDINATES: protein motif:HMM:PF07729.10"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FadR family transcriptional regulator"
                     /protein_id="TIP32761.1"
                     /translation="MDPAVLGWLRASATPRHFIIELLEVRLGFECEAAALAASRNNPD
                     EIAAIREAFEAMRAASSGQGDPVLSDAAFHEAVLAATGNRFFLPLSALIHTALQYSVP
                     TTNALFGHPVGD"
BASE COUNT           52 a          128 c          113 g           64 t
ORIGIN      
        1 aggactggaa tttcttggac cccgcggtgc tgggctggct gcgcgccagc gcgacaccgc
       61 gccacttcat catcgagctt ctggaagtgc gcctgggctt cgaatgcgag gccgcggctc
      121 ttgccgcgag ccgcaacaac ccggatgaga tcgccgccat ccgcgaggcc ttcgaggcga
      181 tgcgcgcggc ctcctccggc cagggcgatc cggtcttgtc ggacgccgct ttccatgaag
      241 cggtgcttgc cgccacaggg aaccgcttct tcctgccgct ctcggcgctg atccacacgg
      301 cactgcagta tagcgtcccg accaccaacg cgctgttcgg tcacccggtg ggcgatc
//