LOCUS       OP888699                 890 bp    cRNA    linear   VRL 28-NOV-2022
DEFINITION  Influenza A virus (A/yellow-billed teal/Chile/C31271/2017(H11N9))
            segment 8 nuclear export protein (NEP) and nonstructural protein 1
            (NS1) genes, complete cds.
ACCESSION   OP888699
VERSION     OP888699.1
DBLINK      BioProject: PRJNA803139
KEYWORDS    .
SOURCE      Influenza A virus
  ORGANISM  Influenza A virus
            Viruses; Riboviria; Orthornavirae; Negarnaviricota;
            Polyploviricotina; Insthoviricetes; Articulavirales;
            Orthomyxoviridae; Alphainfluenzavirus; Alphainfluenzavirus
            influenzae.
REFERENCE   1  (bases 1 to 890)
  AUTHORS   Tan,S., Freiden,P., Sharp,B., Jiminez-Bluhm,P., Mukherjee,N.,
            Hamilton-West,C. and Schultz-Cherry,S.
  CONSRTM   NIAID Centers of Excellence for Influenza Research and Response
            (CEIRR)
  TITLE     Direct Submission
  JOURNAL   Submitted (23-NOV-2022) CEIRR Influenza Data Processing and
            Communication Center, St. Jude Center of Excellence for Influenza
            Research and Response (CEIRR), Memphis, TN 38105, USA
COMMENT     This submission was made by the CEIRR Influenza Data Processing and
            Communication Center (iDPCC) on behalf of the  St. Jude Center of
            Excellence for Influenza Research and Response (CEIRR). This work
            was supported by National Institute of Allergy and Infectious
            Diseases, National Institutes of Health, grant 75N93021C00016.
            
            ##Assembly-Data-START##
            Assembly Method       :: IRMA v. 0.6.7
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..890
                     /organism="Influenza A virus"
                     /mol_type="viral cRNA"
                     /strain="A/yellow-billed teal/Chile/C31271/2017"
                     /serotype="H11N9"
                     /isolation_source="feces"
                     /host="Anas flavirostris"
                     /db_xref="taxon:11320"
                     /segment="8"
                     /geo_loc_name="Chile"
                     /collection_date="13-Sep-2017"
                     /note="passage_history:E2"
     gene            27..864
                     /gene="NEP"
                     /gene_synonym="NS2"
     CDS             join(27..56,529..864)
                     /gene="NEP"
                     /gene_synonym="NS2"
                     /note="nonstructural protein 2"
                     /codon_start=1
                     /product="nuclear export protein"
                     /protein_id="UZU89107.1"
                     /translation="MDSNTVSSFQDILMRMSKMQLGSSSEDLNGMITQFESLKLYRDS
                     LGEAVMRMGDLHSLQSRNGKWREQLSQKFEEIRWLIEEVRHRLKITENSFEQITFMQA
                     LQLLLEVEQEIRTFSFQLI"
     gene            27..719
                     /gene="NS1"
     CDS             27..719
                     /gene="NS1"
                     /codon_start=1
                     /product="nonstructural protein 1"
                     /protein_id="UZU89106.1"
                     /translation="MDSNTVSSFQVDCFLWHVRKRFADQELGDAPFLDRLRRDQKSLR
                     GRGSTLGLDIETATRAGKQIVERILEEESDEALKMTIASVPTSRYLTDMTLEEMSRDW
                     FMLMPKQKIAGSLCIRMDQAIMDKNITLKANFSVIFDRLETLILLRAFTDEGAIVGEI
                     SPLPSLPGHTDEDVENAIGVLIGGLEWNDNTVRVSETLQRFAWRSSHEDGRPPLPPKQ
                     KRKMARTIESEV"
BASE COUNT          276 a          187 c          216 g          211 t
ORIGIN      
        1 agcaaaagca gggtgacaaa aacataatgg actcaaatac tgtgtcaagc tttcaggtag
       61 actgctttct ttggcatgtc cgcaaacgat ttgcagacca agaactgggt gatgccccat
      121 tccttgatcg gcttcgtcga gatcagaagt ccctgagagg aagaggcagc actcttggtc
      181 tggacatcga aacagccacc cgcgcgggga aacagatagt ggaacggatt ctagaggaag
      241 agtccgatga ggcacttaag atgaccattg cctccgttcc tacttcacgc tacctgactg
      301 acatgaccct cgaggaaatg tcaagggact ggttcatgct aatgcctaag cagaagatag
      361 caggctccct atgcattaga atggaccaag caattatgga taagaacatc accttaaaag
      421 caaacttcag tgtaattttt gacaggctgg agacactcat tctgctcaga gctttcaccg
      481 acgagggagc aattgttggc gaaatctcac cattgccttc tcttccagga catactgatg
      541 aggatgtcga aaatgcaatt ggggtcctca tcggaggact tgaatggaat gataacacag
      601 ttcgagtctc tgaaactcta cagagattcg cttggagaag cagtcatgag gatgggagac
      661 ctccactccc tccaaagcag aaacggaaaa tggcgagaac aattgagtca gaagtttgaa
      721 gagataaggt ggttgattga ggaagtgaga cacagattaa agatcacgga aaatagtttt
      781 gaacaaataa cctttatgca agccttgcaa ctgttgcttg aagtggagca agagataaga
      841 actttctcgt ttcagcttat ttaatgataa aaaacaccct tgtttctact
//