LOCUS OP888699 890 bp cRNA linear VRL 28-NOV-2022
DEFINITION Influenza A virus (A/yellow-billed teal/Chile/C31271/2017(H11N9))
segment 8 nuclear export protein (NEP) and nonstructural protein 1
(NS1) genes, complete cds.
ACCESSION OP888699
VERSION OP888699.1
DBLINK BioProject: PRJNA803139
KEYWORDS .
SOURCE Influenza A virus
ORGANISM Influenza A virus
Viruses; Riboviria; Orthornavirae; Negarnaviricota;
Polyploviricotina; Insthoviricetes; Articulavirales;
Orthomyxoviridae; Alphainfluenzavirus; Alphainfluenzavirus
influenzae.
REFERENCE 1 (bases 1 to 890)
AUTHORS Tan,S., Freiden,P., Sharp,B., Jiminez-Bluhm,P., Mukherjee,N.,
Hamilton-West,C. and Schultz-Cherry,S.
CONSRTM NIAID Centers of Excellence for Influenza Research and Response
(CEIRR)
TITLE Direct Submission
JOURNAL Submitted (23-NOV-2022) CEIRR Influenza Data Processing and
Communication Center, St. Jude Center of Excellence for Influenza
Research and Response (CEIRR), Memphis, TN 38105, USA
COMMENT This submission was made by the CEIRR Influenza Data Processing and
Communication Center (iDPCC) on behalf of the St. Jude Center of
Excellence for Influenza Research and Response (CEIRR). This work
was supported by National Institute of Allergy and Infectious
Diseases, National Institutes of Health, grant 75N93021C00016.
##Assembly-Data-START##
Assembly Method :: IRMA v. 0.6.7
Sequencing Technology :: Illumina
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..890
/organism="Influenza A virus"
/mol_type="viral cRNA"
/strain="A/yellow-billed teal/Chile/C31271/2017"
/serotype="H11N9"
/isolation_source="feces"
/host="Anas flavirostris"
/db_xref="taxon:11320"
/segment="8"
/geo_loc_name="Chile"
/collection_date="13-Sep-2017"
/note="passage_history:E2"
gene 27..864
/gene="NEP"
/gene_synonym="NS2"
CDS join(27..56,529..864)
/gene="NEP"
/gene_synonym="NS2"
/note="nonstructural protein 2"
/codon_start=1
/product="nuclear export protein"
/protein_id="UZU89107.1"
/translation="MDSNTVSSFQDILMRMSKMQLGSSSEDLNGMITQFESLKLYRDS
LGEAVMRMGDLHSLQSRNGKWREQLSQKFEEIRWLIEEVRHRLKITENSFEQITFMQA
LQLLLEVEQEIRTFSFQLI"
gene 27..719
/gene="NS1"
CDS 27..719
/gene="NS1"
/codon_start=1
/product="nonstructural protein 1"
/protein_id="UZU89106.1"
/translation="MDSNTVSSFQVDCFLWHVRKRFADQELGDAPFLDRLRRDQKSLR
GRGSTLGLDIETATRAGKQIVERILEEESDEALKMTIASVPTSRYLTDMTLEEMSRDW
FMLMPKQKIAGSLCIRMDQAIMDKNITLKANFSVIFDRLETLILLRAFTDEGAIVGEI
SPLPSLPGHTDEDVENAIGVLIGGLEWNDNTVRVSETLQRFAWRSSHEDGRPPLPPKQ
KRKMARTIESEV"
BASE COUNT 276 a 187 c 216 g 211 t
ORIGIN
1 agcaaaagca gggtgacaaa aacataatgg actcaaatac tgtgtcaagc tttcaggtag
61 actgctttct ttggcatgtc cgcaaacgat ttgcagacca agaactgggt gatgccccat
121 tccttgatcg gcttcgtcga gatcagaagt ccctgagagg aagaggcagc actcttggtc
181 tggacatcga aacagccacc cgcgcgggga aacagatagt ggaacggatt ctagaggaag
241 agtccgatga ggcacttaag atgaccattg cctccgttcc tacttcacgc tacctgactg
301 acatgaccct cgaggaaatg tcaagggact ggttcatgct aatgcctaag cagaagatag
361 caggctccct atgcattaga atggaccaag caattatgga taagaacatc accttaaaag
421 caaacttcag tgtaattttt gacaggctgg agacactcat tctgctcaga gctttcaccg
481 acgagggagc aattgttggc gaaatctcac cattgccttc tcttccagga catactgatg
541 aggatgtcga aaatgcaatt ggggtcctca tcggaggact tgaatggaat gataacacag
601 ttcgagtctc tgaaactcta cagagattcg cttggagaag cagtcatgag gatgggagac
661 ctccactccc tccaaagcag aaacggaaaa tggcgagaac aattgagtca gaagtttgaa
721 gagataaggt ggttgattga ggaagtgaga cacagattaa agatcacgga aaatagtttt
781 gaacaaataa cctttatgca agccttgcaa ctgttgcttg aagtggagca agagataaga
841 actttctcgt ttcagcttat ttaatgataa aaaacaccct tgtttctact
//