LOCUS       OK376603                 396 bp    mRNA    linear   PLN 23-AUG-2022
DEFINITION  Dendrocnide moroides urticatoxin-Dm2a mRNA, complete cds.
ACCESSION   OK376603
VERSION     OK376603.1
KEYWORDS    .
SOURCE      Dendrocnide moroides
  ORGANISM  Dendrocnide moroides
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; fabids; Rosales; Urticaceae; Dendrocnide.
REFERENCE   1  (bases 1 to 396)
  AUTHORS   Xie,J., Robinson,S.D., Gilding,E.K., Jami,S., Deuis,J.R.,
            Rehm,F.B.H., Yap,K., Ragnarsson,L., Chan,L.Y., Hamilton,B.R.,
            Harvey,P.J., Craik,D.J., Vetter,I. and Durek,T.
  TITLE     Neurotoxic and cytotoxic peptides underlie the painful stings of
            the tree nettle Urtica ferox
  JOURNAL   J Biol Chem 298 (8), 102218 (2022)
   PUBMED   35780839
  REMARK    Publication Status: Available-Online prior to print
REFERENCE   2  (bases 1 to 396)
  AUTHORS   Xie,J., Robinson,S.D., Gilding,E.K., Jami,S., Deuis,J.R.,
            Rehm,F.B.H., Yap,K., Ragnarsson,L., Chan,L.Y., Hamilton,B.R.,
            Harvey,P.J., Craik,D.J., Vetter,I. and Durek,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (30-SEP-2021) Institute for Molecular Bioscience, The
            University of Queensland, Building 80, Services Road, Brisbane, Qld
            4072, Australia
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..396
                     /organism="Dendrocnide moroides"
                     /mol_type="mRNA"
                     /isolation_source="cultivated material"
                     /db_xref="taxon:1842752"
                     /geo_loc_name="Australia"
     CDS             1..396
                     /note="disulfide-rich peptide toxin present in stinging
                     hairs (trichomes); urticaceae toxin"
                     /codon_start=1
                     /product="urticatoxin-Dm2a"
                     /protein_id="UVC57621.1"
                     /translation="MKSSATVVLLVAAVTAAMVMSSSASGDAVMIDEHNNIMTSVEGK
                     RGIGSSVVANGGNRKMANVLLSGWENKCAGHGESCLGIGISGCCKGYYCSWPSGSICL
                     CVPKGDPCGAMHTCCDGLSCTGFFSGDCV"
BASE COUNT           83 a           82 c          139 g           92 t
ORIGIN      
        1 atgaagagta gtgccacggt ggtgttgttg gtggcggcgg tgaccgcggc gatggtgatg
       61 tcatcatcgg catccggcga tgccgtgatg atcgatgagc acaataatat catgacgtct
      121 gtggagggca aaagaggaat tggttcatcg gtggtcgcga atggcgggaa caggaagatg
      181 gcgaatgtgt tgctgtcggg gtgggagaac aagtgtgccg gccacggcga gtcgtgttta
      241 ggcatcggca taagcgggtg ttgcaaaggg tattactgct catggccctc cggaagcata
      301 tgcctttgcg tgcccaaagg tgatccttgc ggcgcaatgc acacctgttg cgatggcctt
      361 agctgcaccg gctttttcag tggagactgc gtataa
//