LOCUS       MK006034                 702 bp    DNA     linear   VRL 01-OCT-2020
DEFINITION  Porcine circovirus 2 isolate S171206-19 capsid protein gene,
            complete cds.
ACCESSION   MK006034
VERSION     MK006034.1
KEYWORDS    .
SOURCE      Porcine circovirus 2
  ORGANISM  Porcine circovirus 2
            Viruses; Monodnaviria; Shotokuvirae; Cressdnaviricota;
            Arfiviricetes; Cirlivirales; Circoviridae; Circovirus; Circovirus
            porcine2.
REFERENCE   1  (bases 1 to 702)
  AUTHORS   Ouh,I.-O., Cho,M.-S., Park,S. and Song,J.Y.
  TITLE     Prevalence and genetic characterization of porcine circovirus 2 in
            the Republic of Korea
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 702)
  AUTHORS   Ouh,I.-O., Cho,M.-S., Park,S. and Song,J.Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-OCT-2018) Virology division, Animal and Plant
            Quarantine Agency, Hyeoksin 8-RO, Gimcheon-si, Gyeongsangbuk-do
            39660, Republic of Korea
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..702
                     /organism="Porcine circovirus 2"
                     /mol_type="genomic DNA"
                     /isolate="S171206-19"
                     /host="swine"
                     /db_xref="taxon:85708"
                     /geo_loc_name="South Korea"
                     /collection_date="2017"
     CDS             1..702
                     /note="ORF2"
                     /codon_start=1
                     /product="capsid protein"
                     /protein_id="QBA88440.1"
                     /translation="MTYPRRRFRRRRHRPRSHLGQILRRRPWLVHPRHRYRWRRKNGI
                     FNTRLSRTIGYTVKKTTVRTPSWNVDMMRFNINDFLPPGGGSNPLTVPFEYYRIRKVK
                     VEFWPCSPITQGDRGVGSTAVILDDNFVTKANALTYDPYVNYSSRHTITQPFSYHSRY
                     FTPKPVLDRTIDYFQPNNKRNQLWLRLQTTGNVDHVGLGTAFENSIYDQDYNIRITMY
                     VQFREFNLKDPPLKP"
BASE COUNT          198 a          216 c          132 g          156 t
ORIGIN      
        1 atgacgtatc caaggaggcg tttccgcaga cgaagacacc gcccccgcag ccatcttggc
       61 cagatcctcc gccgccgccc ctggctcgtc cacccccgcc accgttaccg ctggagaagg
      121 aaaaatggca tcttcaacac ccgcctctcc cgcaccatcg gttatactgt caagaaaacc
      181 acagtcagaa cgccctcctg gaatgtggac atgatgagat ttaatattaa tgattttctt
      241 cccccaggag ggggctcaaa ccccctcact gtgccctttg aatactacag aataaggaag
      301 gttaaggttg aattctggcc ctgctcccca atcacccagg gtgacagggg agtgggctcc
      361 actgctgtta ttctagatga taactttgta acaaaggcca atgccctaac ctatgacccc
      421 tatgtaaact actcctcccg ccataccata acccagccct tctcctacca ctcccggtac
      481 tttaccccga aacctgtcct tgataggaca atcgattact tccaacccaa taacaaaaga
      541 aatcaactct ggctgagact acaaactact ggaaatgtag accatgtagg cctcggcact
      601 gcgttcgaaa acagtatata cgaccaggac tacaatatcc gtataaccat gtatgtacaa
      661 ttcagagaat ttaatcttaa agacccccca cttaaacctt ag
//