LOCUS       PD1CRR                   599 bp    DNA     linear   BCT 23-JUL-2016
DEFINITION  Plasmid pCD1 (from Y.pestis) low calcium response locus-encoded
            proteins lcrR and lcrG, complete cds and 5' end.
ACCESSION   M35740
VERSION     M35740.1
KEYWORDS    lcrG gene product; lcrR gene product; low calcium-response protein.
SOURCE      Plasmid pCD1
  ORGANISM  Plasmid pCD1
            other sequences; plasmids.
REFERENCE   1  (bases 1 to 599)
  AUTHORS   Barve,S.S. and Straley,S.C.
  TITLE     lcrR, a low-Ca2(+)-response locus with dual Ca2(+)-dependent
            functions in Yersinia pestis
  JOURNAL   J. Bacteriol. 172 (8), 4661-4671 (1990)
   PUBMED   1695896
COMMENT     Draft entry and computer-readable [or printed] sequence for [J.
            Bacteriol. (1990) In press]
            kindly submitted by S.C. Straley 18-JUL-1990.
FEATURES             Location/Qualifiers
     source          1..599
                     /organism="Plasmid pCD1"
                     /mol_type="genomic DNA"
                     /host="KIM5"
                     /db_xref="taxon:2536"
                     /plasmid="Plasmid pCD1"
     gene            86..91
                     /gene="lcr"
     regulatory      86..91
                     /regulatory_class="ribosome_binding_site"
                     /gene="lcr"
     gene            100..540
                     /gene="lcrR"
     CDS             100..540
                     /gene="lcrR"
                     /codon_start=1
                     /transl_table=11
                     /protein_id="AAA98219.1"
                     /translation="MMADLLIPWLTEHGLVCHPHTLSGTPISLGSAFQLAGLKLAWRV
                     EIEQRRVWIVLIQRVEQRRGLKNPFAALYMLANAARAVLGPDYYLYGNVDVLAGSSLS
                     TQRLAHFYRRWTGAKELSTGWFSLKVSQVITLSNMKKRQNNGFA"
     gene            582..599
                     /gene="lcrG"
     CDS             582..>599
                     /gene="lcrG"
                     /codon_start=1
                     /transl_table=11
                     /protein_id="AAA98220.1"
                     /translation="MKSSHF"
BASE COUNT          158 a          138 c          139 g          164 t
ORIGIN      
        1 gcgcaaactg attgagagcg aatactatgg cttgccggta ctttcatacc aagagctgac
       61 tcagcagatt aatatccaac cacttggacg aatttgctta tgatggcaga ccttttaatt
      121 ccgtggctta ccgaacatgg cttggtttgc caccctcata ctttgtctgg cacccccatt
      181 tctttaggtt cggcctttca attagctggc ctcaagcttg cctggcgcgt agaaattgaa
      241 caaaggcggg tttggatcgt gcttatccaa cgagtggaac aacgtcgagg gctgaaaaat
      301 cccttcgcgg cactttatat gttagctaat gcagcgcggg ccgttcttgg ccctgactat
      361 tatctgtatg gcaatgtcga tgtactggcg gggagttctc tcagtacgca acggctcgct
      421 catttttatc ggcgttggac cggggccaaa gaattaagca ccgggtggtt ctcactaaaa
      481 gtatcacaag tcatcacctt atctaatatg aaaaagcgac aaaacaacgg ctttgcctga
      541 caagctaaat aaaaataacg taatagaata ggaggtagat tatgaagtct tcccatttt
//