LOCUS       ECOBIRAA                1038 bp    DNA     linear   BCT 26-APR-1993
DEFINITION  E.coli birA gene coding for BirA protein, wt and mutant alleles.
ACCESSION   M15820
VERSION     M15820.1
KEYWORDS    DNA-binding protein; biotin operon repressor; biotin-holoenzyme
            synthetase; birA gene.
SOURCE      Escherichia coli
  ORGANISM  Escherichia coli
            Bacteria; Pseudomonadota; Gammaproteobacteria; Enterobacterales;
            Enterobacteriaceae; Escherichia.
REFERENCE   1  (bases 1 to 1038)
  AUTHORS   Buoncristiani,M.R., Howard,P.K. and Otsuka,A.J.
  TITLE     DNA-binding and enzymatic domains of the bifunctional biotin operon
            repressor (BirA) of Escherichia coli
  JOURNAL   Gene 44 (2-3), 255-261 (1986)
   PUBMED   3536662
COMMENT     Original source text: E.coli (strain BM2661 derivatives) DNA.
            Draft entry and printed copy of sequence [1] kindly provided by
            A.J.Otsuka, 01-JUN-1987.
            A ribosome binding site is located at positions 3-6.
FEATURES             Location/Qualifiers
     source          1..1038
                     /organism="Escherichia coli"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:562"
                     /map="89.9"
     variation       4
                     /note="g in wt; t in birA707 [1]"
     gene            15..980
                     /gene="birA"
     CDS             15..980
                     /gene="birA"
                     /EC_number="6.3.4.15"
                     /codon_start=1
                     /transl_table=11
                     /product="biotin-holoenzyme synthetase"
                     /protein_id="AAA23521.1"
                     /translation="MKDNTVPLKLIALLANGEFHSGEQLGETLGMSRAAINKHIQTLR
                     DWGVDVFTVPGKGYSLPEPIQLLNAKQILGQLDGGSVAVLPVIDSTNQYLLDRIGELK
                     SGDACIAEYQQAGRGRRGRKWFSPFGANLYLSMFWRLEQGPAAAIGLSLVIGIVMAEV
                     LRKLGADKVRVKWPNDLYLQDRKLAGILVELTGKTGDAAQIVIGAGINMAMRRVEESV
                     VNQGWITLQEAGINLDRNTLAAMLIRELRAALELFEQEGLAPYLSRWEKLDNFINRPV
                     KLIIGDKEIFGISRGIDKQGALLLEQDGIIKPWMGGEISLRSAEK"
     variation       26..39
                     /gene="birA"
                     /note="caccgtgccactga in wt; ca in birA207 [1]"
     variation       109
                     /gene="birA"
                     /note="g in wt; t in birA106 [1]"
     variation       110
                     /gene="birA"
                     /note="c in wt; g in birA361 [1]"
     variation       112
                     /gene="birA"
                     /note="g in wt; t in birA825 [1]"
     variation       115
                     /gene="birA"
                     /note="c in wt; a in birA331 [1]"
     misc_feature    124..125
                     /gene="birA"
                     /note="insertion site in plasmid pA20 [1]"
     variation       262
                     /gene="birA"
                     /note="t in wt; g in birA879 [1]"
     variation       323
                     /gene="birA"
                     /note="t in wt; g in birA815 [1]"
     variation       357
                     /gene="birA"
                     /note="g in wt; a in birA1 [1]"
     variation       366
                     /gene="birA"
                     /note="c in wt; g in birA91 [1]"
     variation       369
                     /gene="birA"
                     /note="c in wt; t in birA352 [1]"
     variation       438
                     /gene="birA"
                     /note="g in wt; t in birA71 [1]"
     variation       448..452
                     /gene="birA"
                     /note="cggcg in wt; cg in birA881 [1]"
     variation       580
                     /gene="birA"
                     /note="t in wt; g in birA215 [1]"
     variation       603
                     /gene="birA"
                     /note="g in wt; t in birA301 [1]"
     variation       634
                     /gene="birA"
                     /note="t in wt; g in birA104 [1]"
     variation       717
                     /gene="birA"
                     /note="c in wt; t in birA85 [1]"
BASE COUNT          261 a          211 c          301 g          265 t
ORIGIN      
        1 gtggagacaa tttcatgaag gataacaccg tgccactgaa attgattgcc ctgttagcga
       61 acggtgaatt tcactctggc gagcagttgg gtgaaacgct gggaatgagc cgggcggcta
      121 ttaataaaca cattcagaca ctgcgtgact ggggcgttga tgtctttacc gttccgggta
      181 aaggatacag cctgcctgag cctatccagt tacttaatgc taaacagata ttgggtcagc
      241 tggatggcgg tagtgtagcc gtgctgccag tgattgactc cacgaatcag taccttcttg
      301 atcgtatcgg agagcttaaa tcgggcgatg cttgcattgc agaataccag caggctggcc
      361 gtggtcgccg gggtcggaaa tggttttcgc cttttggcgc aaacttatat ttgtcgatgt
      421 tctggcgtct ggaacaaggc ccggcggcgg cgattggttt aagtctggtt atcggtatcg
      481 tgatggcgga agtattacgc aagctgggtg cagataaagt tcgtgttaaa tggcctaatg
      541 acctctatct gcaggatcgc aagctggcag gcattctggt ggagctgact ggcaaaactg
      601 gcgatgcggc gcaaatagtc attggagccg ggatcaacat ggcaatgcgc cgtgttgaag
      661 agagtgtcgt taatcagggg tggatcacgc tgcaggaagc ggggatcaat ctcgatcgta
      721 atacgttggc ggccatgcta atacgtgaat tacgtgctgc gttggaactc ttcgaacaag
      781 aaggattggc accttatctg tcgcgctggg aaaagctgga taattttatt aatcgcccag
      841 tgaaacttat cattggtgat aaagaaatat ttggcatttc acgcggaata gacaaacagg
      901 gggctttatt acttgagcag gatggaataa taaaaccctg gatgggcggt gaaatatccc
      961 tgcgtagtgc agaaaaataa gaaaggggag tattcgctcc cctgcaaatt atttgcgtag
     1021 tctgacctct tctaccgc
//