LOCUS       ECONADE                 1501 bp    DNA     linear   BCT 23-OCT-1995
DEFINITION  Escherichia coli NH3-dependent NAD synthetase (nadE) gene, complete
            cds.
ACCESSION   M15328
VERSION     M15328.1
KEYWORDS    NH3-dependent NAD synthetase; nadE gene; nitrogen fixation protein.
SOURCE      Escherichia coli
  ORGANISM  Escherichia coli
            Bacteria; Pseudomonadota; Gammaproteobacteria; Enterobacterales;
            Enterobacteriaceae; Escherichia.
REFERENCE   1  (bases 1 to 1501)
  AUTHORS   Allibert,P., Willison,J.C. and Vignais,P.M.
  TITLE     Complementation of nitrogen-regulatory (ntr-like) mutations in
            Rhodobacter capsulatus by an Escherichia coli gene: cloning and
            sequencing of the gene and characterization of the gene product
  JOURNAL   J. Bacteriol. 169 (1), 260-271 (1987)
   PUBMED   3025172
REFERENCE   2  (sites)
  AUTHORS   Reimmann,C., Moore,R., Little,S., Savioz,A., Willetts,N.S. and
            Haas,D.
  TITLE     Genetic structure, function and regulation of the transposable
            element IS21
  JOURNAL   Mol. Gen. Genet. 215 (3), 416-424 (1989)
   PUBMED   2540414
REFERENCE   3  (sites)
  AUTHORS   Willison,J.C.
  TITLE     An essential gene (efg) located at 38.1 minutes on the Escherichia
            coli chromosome
  JOURNAL   J. Bacteriol. 174 (17), 5765-5766 (1992)
   PUBMED   1512214
REFERENCE   4  (sites)
  AUTHORS   Willison,J.C.
  TITLE     Biochemical genetics revisited: the use of mutants to study carbon
            and nitrogen metabolism in the photosynthetic bacteria
  JOURNAL   FEMS Microbiol. Rev. 10 (1-2), 1-38 (1993)
   PUBMED   8431308
REFERENCE   5  (sites)
  AUTHORS   Willison,J.C. and Tissot,G.
  TITLE     The Escherichia coli efg gene and the Rhodobacter capsulatus adgA
            gene code for NH3-dependent NAD synthetase
  JOURNAL   J. Bacteriol. 176 (11), 3400-3402 (1994)
   PUBMED   8195100
COMMENT     On Oct 5, 1995 this sequence version replaced gi:146973.
            Original source text: Escherichia coli DNA; and Insertion sequence
            IS21 DNA.
            Draft entry and printed copy of sequence [1] kindly submitted by
            J.C.Willison, 27-SEP-1987.
FEATURES             Location/Qualifiers
     source          1..1501
                     /organism="Escherichia coli"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:562"
                     /map="38.1 min"
     gene            37..1051
                     /gene="nadE"
     regulatory      37..42
                     /regulatory_class="minus_35_signal"
                     /gene="nadE"
                     /note="putative"
     regulatory      58..63
                     /regulatory_class="minus_10_signal"
                     /gene="nadE"
                     /note="putative"
     regulatory      216..220
                     /regulatory_class="ribosome_binding_site"
                     /gene="nadE"
                     /note="putative"
     CDS             227..1051
                     /gene="nadE"
                     /standard_name="efg"
                     /note="E. coli nadE gene product can be aligned with
                     C-terminal region of R. capsulatus nadE (adgA) gene
                     product; amino acid feature: conserved glycine-rich
                     sequence motif, aa 32-58"
                     /citation=[3]
                     /citation=[4]
                     /citation=[5]
                     /codon_start=1
                     /transl_table=11
                     /product="NH3-dependent NAD synthetase"
                     /protein_id="AAA79852.1"
                     /translation="MTLQQQIIKALGENRRLMLKRKFVVVSISESYLQTYPFIKSLVL
                     GISGGQDSTLAGKLCQMAINELRLETGNESLQFIAVRLPYGVQADEQDCQDAIAFIQP
                     DRVLTVNIKGAVLASEQALREAGIELSDFVRGNEKARERMKAQYSIAGMTSGVVVGTD
                     HAAEAITGFFTKYGDGGTDINPLYRLNKRQGKQLLAALACPEHLYKKAPTADLEDDRP
                     SLPDEVALGVTYDNIDDYLEGKNVPQQVARTIENWYLKTEHKRRPPITVFDDFWKK"
BASE COUNT          398 a          358 c          363 g          382 t
ORIGIN      
        1 gaattcctgc catattcttg ttcatattcc gtcctcttgt ttatcagcgt gttagataag
       61 cctggaatac attgggcgct ttttcaagcc cgtgaacgaa acggctccgc tttcagagga
      121 ttcctgtatg acgttttaac caccattcag cccgctgtcg cttgtcgttt cagtagcaac
      181 gggttagctt taaggaagtt ttgtcttttc tgtctggagg ggttcaatga cattgcaaca
      241 acaaataata aaggcgctgg gcgaaaaccg cagattaatg ctgaagagga aattcgtcgt
      301 agtgtcgatt tctgaaagct acctgcaaac ttatccgttc attaaatcac tggtgctcgg
      361 gatcagcggc ggtcaggact ccacgcttgc cggaaagctg tgccagatgg cgattaatga
      421 gctgcgcctg gaaaccggca acgaatcact gcaatttatt gccgtacgcc tgccctatgg
      481 tgttcaggcc gacgaacaag attgccagga tgccattgcc tttattcaac cggatcgcgt
      541 attaaccgtt aatatcaagg gcgcggtatt ggccagcgaa caggcattgc gggaagcagg
      601 cattgaactg agcgattttg tccgtggcaa tgaaaaagcg cgtgagcgga tgaaagcaca
      661 atatagcatt gcgggtatga ccagcggtgt cgtggtgggc accgatcatg cagcagaagc
      721 cattaccgga ttcttcacta aatatggtga cggcggtacg gacattaatc cgctgtatcg
      781 tctcaacaaa cgtcagggta aacagttact ggcggcatta gcttgcccgg aacaccttta
      841 taagaaagcg ccaacggccg atctggaaga tgatcgccct tctctgccag atgaagtggc
      901 actcggcgtg acctatgaca atatcgacga ctatctggaa gggaaaaacg tacctcaaca
      961 ggtcgccaga acaatagaga actggtatct gaaaaccgaa cataaacgcc gtccgccaat
     1021 taccgttttc gatgatttct ggaaaaagta ataatttgca catattggat tgtgcgaaaa
     1081 agagtaattt gttcacgccg gatgcgcgtg aacgccttat tcgacctata aaactatgca
     1141 aattcaatac attgcaggag tcgaataggc ctgacaggcg tagcacgtca gacggtgtaa
     1201 cctttgtcat cgacccgcct cttttttaat cgcttcccgc ctgttacact ggatagataa
     1261 ccagcattcg gagtcaacag tggtacggcg tttaacttct ccgcggctcg aatttgaagc
     1321 tgcggcaatt tatgaatatc ccgaacattt acgttcattc cttaatgact tacccacccg
     1381 accagggtgt tgtgcagcgc cagtgatata agacggtaat tcaccatttg gattgtccgc
     1441 tccacccaac atgttgtttc cttaaggttc tcacaccaga aaggacatca acatgctgag
     1501 c
//