LOCUS LR761080 501 bp DNA linear ROD 25-JAN-2021 DEFINITION TPA: Cavia porcellus IF2F gene for interferon 2F. ACCESSION LR761080 VERSION LR761080.1 DBLINK BioProject:PRJEB36709 KEYWORDS Third Party Data; TPA; TPA:inferential.. SOURCE Cavia porcellus (domestic guinea pig) ORGANISM Cavia porcellus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Hystricomorpha; Caviidae; Cavia. REFERENCE 1 AUTHORS Premzl M. JOURNAL Submitted (11-FEB-2020) to the INSDC. The Australian National University Alumni, 4 Kninski trg sq., Zagreb, Croatia REFERENCE 2 AUTHORS Premzl M. TITLE Comparative genomic analysis of eutherian interferon genes JOURNAL Genomics 112, 4749-4759(2020). COMMENT The third party data gene data set of eutherian interferon genes LR760818-LR761312 was deposited in European Nucleotide Archive under open science research project "Comparative genomic analysis of eutherian genes". These 495 complete coding sequences were curated using tests of reliability of eutherian public genomic sequences included in eutherian comparative genomic analysis protocol including gene annotations, phylogenetic analysis and protein molecular evolution analysis. Project leader: Marko Premzl PhD ; E-mail address: Marko.Premzl@alumni.anu.edu.au ; Internet: https://www.ncbi.nlm.nih.gov/myncbi/mpremzl/cv/130205/ PRIMARY TPA_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 604-717 TI1608642846.0 1-114 407-475 TI1673024024.0 115-183 571-759 TI1673024024.0 184-372 313-441 TI1701527267.0 373-501 c FEATURES Location/Qualifiers source 1..501 /organism="Cavia porcellus" /mol_type="genomic DNA" /db_xref="taxon:10141" CDS 1..501 /transl_table=1 /gene="IF2F" /product="interferon 2F" /protein_id="CAB0000259.1" /translation="MKYTSSILALQFCIILSFSSYYCQSRFTNEIRILKNYFNADNSD VGDNGTLFVGILKNCQEESERKIFQSQIVSFYFKLFEKHFTDNQTVQNSMNTIKEQII TKFFKDNSSNKVQAFKNLIQISVNDEHVQRQAIIELKKVIDDLSPNQRKRRRTQMLFQ SRRASK" BASE COUNT 180 a 102 c 94 g 125 t ORIGIN 1 atgaagtata caagttccat cttggctctt cagttctgta tcattttgag tttttctagc 61 tactactgcc agtcaagatt tacaaatgaa atacgcattc taaagaacta ctttaatgca 121 gataactcag atgtaggaga caatgggacg ctctttgtag gcattttgaa gaattgccaa 181 gaggagagtg aaagaaaaat atttcagagc caaatcgtct ccttctactt caaactcttt 241 gaaaaacatt ttacagacaa tcagactgtc caaaatagca tgaacaccat caaggaacaa 301 atcattacta agttcttcaa agacaacagc agcaacaagg tgcaggcttt caaaaacctg 361 attcaaattt cggtcaatga cgagcatgtc cagcgccaag cgatcattga actcaaaaaa 421 gtgatagatg acctgtcacc gaaccagagg aaacgaagaa ggactcagat gctgtttcag 481 agccggagag catccaaata a //