LOCUS       TIPTRAI                 1025 bp    DNA     linear   BCT 17-OCT-2017
DEFINITION  Agrobacterium tumefaciens plasmid pTiC58 conjugation factor
            synthase (traI) gene, complete cds.
ACCESSION   L22207
VERSION     L22207.1
KEYWORDS    conjugation factor.
SOURCE      Agrobacterium tumefaciens (Rhizobium radiobacter)
  ORGANISM  Agrobacterium tumefaciens
            Bacteria; Pseudomonadota; Alphaproteobacteria; Hyphomicrobiales;
            Rhizobiaceae; Rhizobium/Agrobacterium group; Agrobacterium;
            Agrobacterium tumefaciens complex.
REFERENCE   1  (bases 1 to 1025)
  AUTHORS   Hwang,I., Li,P.L., Zhang,L., Piper,K.R., Cook,D.M., Tate,M.E. and
            Farrand,S.K.
  TITLE     TraI, a LuxI homologue, is responsible for production of
            conjugation factor, the Ti plasmid N-acylhomoserine lactone
            autoinducer
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 91 (11), 4639-4643 (1994)
   PUBMED   8197112
FEATURES             Location/Qualifiers
     source          1..1025
                     /organism="Agrobacterium tumefaciens"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:358"
                     /plasmid="pTiC58"
     gene            66..866
                     /gene="traI"
     protein_bind    66..79
                     /gene="traI"
                     /note="putative"
                     /bound_moiety="TraR regulator"
                     /function="regulation of traI expression"
     protein_bind    157..170
                     /gene="traI"
                     /note="putative"
                     /bound_moiety="TraR regulator"
                     /function="regulation of traI expression"
     regulatory      221..226
                     /regulatory_class="ribosome_binding_site"
                     /gene="traI"
                     /note="putative"
     CDS             231..866
                     /gene="traI"
                     /function="synthesis of N-(B-oxo-octan-1-oyl)-L-homoserine
                     lactone"
                     /note="deduced amino acid sequence has high homology with
                     LuxI of Vibrio fischeri, LasI of Pseudomonas aeruginosa,
                     and ExpI of Erwinia carotovora"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugation factor synthase"
                     /protein_id="AAA27405.1"
                     /translation="MRILTVSPDQYERYRSFLKQMHRLRATVFGGRLEWDVSIIAGEE
                     RDQYDNFKPSYLLAITDSGRVAGCVRLLPACGPTMLEQTFSQLLEMGSLAAHSGMVES
                     SRFCVDTSLVSRRDASQLHLATLTLFAGIIEWSMASGYTEIVTATDLRFERILKRAGW
                     PMRRLGEPTAIGNTIAIAGRLPADRASFEQVCPPGYYSIPRIDVAAIRSAA"
BASE COUNT          194 a          322 c          285 g          224 t
ORIGIN      
        1 cccgattctt caaatgctat ctgtgagtta gaccgattcc cttcttctgt gcgacgtggc
       61 accaagtgca gatctgcaca accttgtcgg cgtctggtcg gcctcacccg ctcgcatttc
      121 gcgccttgga acaccgactc ggtagaatca cctgaggtgc aaatctgcac gtaggcaaac
      181 gcaccgtgag atgatttctg ttcgcatgac ctgttcatgc ggagattacg atgcggatac
      241 tcacagtttc gccggaccaa tacgaacggt atcgaagctt cctcaaacag atgcaccgcc
      301 ttcgcgcgac ggtgttcggt ggccgtctcg aatgggacgt ctccatcatc gctggggaag
      361 agcgcgacca atacgataat ttcaagccga gctaccttct ggcgattact gacagtgggc
      421 gggtcgccgg atgcgtcaga cttcttccgg cttgcgggcc tacgatgctg gagcagactt
      481 tttcgcaact cctcgaaatg ggctcgctcg cagcgcattc cggaatggta gagagctctc
      541 gcttctgcgt cgacacctcc ctcgtctcac ggagagatgc gagccagctg cacctggcga
      601 ctcttacctt attcgccggt atcattgaat ggtcgatggc cagcggctac acggagatcg
      661 tcacggcgac cgatcttcgt ttcgagcgca tcctgaagcg tgctggatgg ccgatgcgcc
      721 ggcttggtga acccaccgcg atcggcaaca ccattgccat tgccggaaga ctgccagccg
      781 atcgtgccag cttcgagcag gtttgccctc cgggctacta ttctatcccc cggatcgacg
      841 tggcagcgat caggagtgcc gcgtgaccca gctgcgctct cactcccgtc tcgtccgcaa
      901 actccaggac gcactcggcg accagctctg cgtcgcgctc gatgacgcga cggtcgtcga
      961 gatcatgctc aaccccgatg gtaagctctt catcgagcgc ctgggccatg gcgtggcccc
     1021 tgcag
//