LOCUS       BACSPORLG                716 bp    DNA     linear   BCT 24-SEP-1993
DEFINITION  Bacillus subtilis sporulation factor (spoVM) gene and ribosomal
            protein L28 gene, complete cds's.
ACCESSION   L12244
VERSION     L12244.1
KEYWORDS    ribosomal protein L28; spoVM gene; sporulation factor.
SOURCE      Bacillus subtilis
  ORGANISM  Bacillus subtilis
            Bacteria; Bacillota; Bacilli; Bacillales; Bacillaceae; Bacillus.
REFERENCE   1  (bases 1 to 716)
  AUTHORS   Levin,P.A., Fan,N., Ricca,E., Driks,A., Losick,R. and Cutting,S.
  TITLE     An unusually small gene required for sporulation by Bacillus
            subtilis
  JOURNAL   Mol. Microbiol. 9 (4), 761-771 (1993)
   PUBMED   8231808
COMMENT     Original source text: Bacillus subtilis (sub_strain PY79, strain
            W168) sporulation DNA.
FEATURES             Location/Qualifiers
     source          1..716
                     /organism="Bacillus subtilis"
                     /mol_type="unassigned DNA"
                     /db_xref="taxon:1423"
     regulatory      20..29
                     /regulatory_class="minus_35_signal"
     regulatory      42..49
                     /regulatory_class="minus_10_signal"
     gene            130..224
                     /gene="spoVM"
     regulatory      130..135
                     /regulatory_class="ribosome_binding_site"
                     /gene="spoVM"
     CDS             144..224
                     /gene="spoVM"
                     /codon_start=1
                     /transl_table=11
                     /protein_id="AAC36809.1"
                     /translation="MKFYTIKLPKFLGGIVRAMLGSFRKD"
     CDS             complement(297..485)
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal protein L28"
                     /protein_id="AAC36810.1"
                     /translation="MARKCVITGKKTTAGNNRSHAMNASKRTWGANLQKVRILVNGKP
                     KKVYVSARALKSGKVERV"
     regulatory      complement(493..498)
                     /regulatory_class="ribosome_binding_site"
BASE COUNT          213 a          153 c          142 g          208 t
ORIGIN      
        1 gaactcattc attcacgagg tactttttcg tttgcaaaag gcatattaat aatgataaga
       61 agcacggatt aagcatgtgc tttcattcaa ttgctgaaaa caatgaacaa ggcggttacg
      121 ggacgttata ggaggggaca aaaatgaaat tttacaccat taaattgccg aagtttttag
      181 gaggaattgt ccgggcgatg ctgggctcat ttagaaaaga ttaatgccca ggggttcaaa
      241 gccctctttc accacataaa aacgcctgcc acatatcggg gcaggcgttc attttgttat
      301 acacgctcaa ctttaccgga tttcaaagct cgagcagata catatacttt tttaggtttt
      361 ccgttcacaa ggatacgaac cttttgaaga ttcgcgcccc aagtgcgctt agaagcgttc
      421 attgcgtgag aacggttatt cccagctgtt gtttttttac ctgtgataac gcatttacgt
      481 gccatttgtt tccctcctca cttgcacaaa acatctactt tttaacattc atataatctt
      541 agatgctttc gatatggata ctgatgaggc gctttattca gcaggcgctg acccaatatg
      601 cagactcact tcctgatcct cttccggaaa agctaagaaa aagctataaa ctgcctgact
      661 attatcaagc gttaaaagca atgcaccagc ctgaaacaag ggaaacatta aagctt
//