LOCUS       HUMCT                    109 bp    mRNA    linear   HUM 01-NOV-1994
DEFINITION  Human calcitonin mRNA, partial.
ACCESSION   K03513
VERSION     K03513.1
KEYWORDS    alternative splicing; calcitonin; neuropeptide Y.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 109)
  AUTHORS   Nelkin,B.D., Rosenfeld,K.I., de Bustros,A., Leong,S.S., Roos,B.A.
            and Baylin,S.B.
  TITLE     Structure and expression of a gene encoding human calcitonin and
            calcitonin gene related peptide
  JOURNAL   Biochem. Biophys. Res. Commun. 123 (2), 648-655 (1984)
   PUBMED   6148938
COMMENT     Original source text: Human medullary thyroid carcinoma cell line
            TT, cDNA to rat mRNA, clone pTT42.
            Clean copy sequence for [1] kindly provided by B.D.Nelkin,
            23-MAY-1985.  The calcitonin and calcitonin gene related peptide
            are encoded by the same gene.  They are obtained by alternative
            splicing.
FEATURES             Location/Qualifiers
     source          1..109
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /map="11p15.2-p15.1"
     gene            1..109
                     /gene="CALCA"
     CDS             <1..>109
                     /gene="CALCA"
                     /note="calcitonin"
                     /codon_start=1
                     /protein_id="AAA52124.1"
                     /db_xref="GDB:G00-120-571"
                     /translation="RLLLAALVQDYVQMKASELEQEQEREGSSLDSPRSK"
BASE COUNT           26 a           31 c           36 g           16 t
ORIGIN      Chromosome 11p15.4.
        1 cgcctcctgc tggctgcact ggtccaggac tatgtgcaga tgaaggccag tgagctggag
       61 caggagcaag agagagaggg ctccagcctc gacagcccca gatctaagc
//