LOCUS       NPHP                     255 bp    DNA     linear   VRL 02-AUG-1993
DEFINITION  Autographa californica nuclear polyhedrosis virus (AcNPV)
            polyhedrin gene, coding for the major occlusion protein.
ACCESSION   K02700
VERSION     K02700.1
KEYWORDS    major occlusion protein; polyhedrin.
SOURCE      Autographa californica nucleopolyhedrovirus
  ORGANISM  Autographa californica nucleopolyhedrovirus
            Viruses; Viruses incertae sedis; Naldaviricetes; Lefavirales;
            Baculoviridae; Alphabaculovirus; Alphabaculovirus aucalifornicae.
REFERENCE   1  (bases 1 to 255)
  AUTHORS   Pennock,G.D., Shoemaker,C. and Miller,L.K.
  TITLE     Strong and regulated expression of Escherichia coli
            beta-galactosidase in insect cells with a baculovirus vector
  JOURNAL   Mol. Cell. Biol. 4 (3), 399-406 (1984)
   PUBMED   6325875
COMMENT     Original source text: A.californica nuclear polyhedrosis virus
            (wild type L-1) DNA, passed in Spodoptera frugiperda IPLB-SF-21
            cells, clone pEXS942B6.
            The N-terminal region of the polyhedrin gene was fused to the
            E.coli beta-galactosidase gene and inserted into the AcNPV genome.
            The synthesis of beta-galactosidase was temporarily controlled, but
            started after the release of infectious particles from the cell.
            [1] reports that AcNPV should be a useful vector for the stable
            propagation and expression of passenger genes.
FEATURES             Location/Qualifiers
     source          1..255
                     /organism="Autographa californica nucleopolyhedrovirus"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:46015"
     CDS             1..>255
                     /note="polyhedrin (major occlusion protein)"
                     /codon_start=1
                     /protein_id="AAA46722.1"
                     /translation="MPDYSYRPTIGRTYVYDNKYYKNLGAVIKNAKRKKHFAEHEIEE
                     ATLDPLDNYLVAEDPFLGPGKNQKLTLFKEIRNVKPDTMKL"
BASE COUNT           80 a           73 c           51 g           51 t
ORIGIN      171 bp upstream of BamHI site.
        1 atgccggatt attcataccg tcccaccatc gggcgtacct acgtgtacga caacaagtac
       61 tacaaaaatt taggtgccgt tatcaagaac gctaagcgca agaaacactt cgccgaacat
      121 gagatcgaag aggctaccct cgacccccta gacaactacc tagtggctga ggatcctttc
      181 ctgggacccg gcaagaacca aaaactcact ctcttcaagg aaatccgtaa tgttaaaccc
      241 gacacgatga agctt
//