LOCUS       TRN501                  1340 bp    DNA     linear   BCT 26-JUL-2016
DEFINITION  Pseudomonas aeruginosa Transposon Tn501 mercuric ion resistance
            operon.
ACCESSION   K02503
VERSION     K02503.1
KEYWORDS    insertion sequence; mercuric reductase; transposon.
SOURCE      Pseudomonas aeruginosa
  ORGANISM  Pseudomonas aeruginosa
            Bacteria; Pseudomonadota; Gammaproteobacteria; Pseudomonadales;
            Pseudomonadaceae; Pseudomonas.
REFERENCE   1  (bases 1 to 1340)
  AUTHORS   Misra,T.K., Brown,N.L., Fritzinger,D.C., Pridmore,R.D.,
            Barnes,W.M., Haberstroh,L. and Silver,S.
  TITLE     Mercuric ion-resistance operons of plasmid R100 and transposon
            Tn501: the beginning of the operon including the regulatory region
            and the first two structural genes
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 81 (19), 5975-5979 (1984)
   PUBMED   6091128
COMMENT     Potential -35 regions are found at positions 132-136 and 554-558
            and -10 regions at positions 151-158 and 577-583.
FEATURES             Location/Qualifiers
     source          1..1340
                     /organism="Pseudomonas aeruginosa"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:287"
     mobile_element  1..1340
                     /mobile_element_type="transposon:Tn501"
     repeat_region   1..38
                     /note="Tn501 IR"
                     /rpt_type=inverted
     gene            232..414
                     /gene="merR"
     CDS             232..414
                     /gene="merR"
                     /codon_start=1
                     /transl_table=11
                     /product="MerR"
                     /protein_id="AAA27432.1"
                     /translation="MRARSAIFSRTSLSLCSARLLASSQWVPSSSRSSSAISSRLKPS
                     RWADFTKRTRVTSASP"
     gene            620..970
                     /gene="merT"
     CDS             620..970
                     /gene="merT"
                     /note="putative"
                     /codon_start=1
                     /transl_table=11
                     /product="MerT"
                     /protein_id="AAA27433.1"
                     /translation="MSEPKTGRGALFTGGLAAILASACCLGPLVLIALGFSGAWIGNL
                     AVLEPYRPIFIGVALVALFFAWRRIYRQAAACKPGEVCAIPQVRATYKLIFWIVAALV
                     LVALGFPYVMPFFY"
     gene            983..1258
                     /gene="merC"
     CDS             983..1258
                     /gene="merC"
                     /codon_start=1
                     /transl_table=11
                     /product="MerC"
                     /protein_id="AAA27434.1"
                     /translation="MKKLFASLALAAVVAPVWAATQTVTLSVPGMTCSACPITVKKAI
                     SEVEGVSKVDVTFETRQAVVTFDDAKTSVQKLTKATADAGYPSSVKQ"
     CDS             1330..>1340
                     /codon_start=1
                     /transl_table=11
                     /product="unknown"
                     /protein_id="AAM54742.1"
                     /translation="MTHL"
BASE COUNT          270 a          421 c          367 g          282 t
ORIGIN      
        1 gggggaaccg cagaattcgg aaaaaatcgt acgctaagct aacggtgttc tcgtgacagc
       61 tctttgacta ggctttctaa ggggtcgtct cagaaaacgg aaaataaagc acgctaaggc
      121 atagccgaac ctgccaagct tgctccaccc tgtagtgacg cgatcagcgg gcaggaaacg
      181 ttcccccttc gcgcatggca ggcgcacacc aactcagaca gcacggcctc catgcgcgcc
      241 aggtcagcca ttttctcgcg cacgtccttg agcttgtgct cggccagact gctggcttcc
      301 tcgcaatggg tgccatcctc cagccgcagc agctcggcga tctcatccag gctgaagccc
      361 agccgctggg ctgatttcac gaagcgcacc cgcgttacat ccgcctcgcc atagcggcgg
      421 atgctgccat agggcttgtc aggctccagc aacaagccct tgcgctgata gaaacggatg
      481 gtctccacat tgaccccggc cgccttggcg aaaacgccaa tggtcaggtt ctccaaattg
      541 ttttccatat cgcttgactc cgtacatgag tacggaagta aggttacgct atccaatttc
      601 aattcgaaag gacaagcgca tgtctgaacc aaaaaccggg cgcggcgcgc tcttcactgg
      661 agggcttgcc gccatcctcg cctcggcttg ctgcctcggg ccgttggttc tgatcgcctt
      721 ggggttcagc ggcgcttgga tcggcaactt ggcggtgttg gaaccctatc gccccatctt
      781 tatcggcgtg gcgctggtgg cgttgttctt cgcctggcgg cgcatctacc ggcaggcagc
      841 ggcctgcaaa ccgggtgagg tctgcgcgat tccccaagtg cgagctactt acaagctcat
      901 tttctggatc gtggccgcgc tggttctggt cgcgctcgga tttccctacg tcatgccatt
      961 tttctactga tcggagttca ccatgaagaa actgtttgcc tccctcgccc tcgccgccgt
     1021 tgttgccccc gtctgggccg ccacccagac cgtcacgctg tccgtaccgg gcatgacctg
     1081 ctccgcctgc ccgatcactg tcaagaaggc gatttccgag gtcgaaggcg tcagcaaagt
     1141 tgacgtgact ttcgagacac gccaagcggt cgtcaccttc gacgatgcca agaccagcgt
     1201 gcagaagctg accaaggcaa ccgcagacgc gggctatccg tccagcgtca agcagtgagt
     1261 cactgaaaac ggcaccgcag cacaacggac gtcattgtct ggcgccacaa acgataaagg
     1321 atctgttgca tgacccatct
//