LOCUS       PJRHPH                  1527 bp    DNA     linear   BCT 23-JUL-2016
DEFINITION  Plasmid pJR225 (from E.coli) hygromycin B phosphotransferase (hgh)
            gene, complete cds.
ACCESSION   K01193
VERSION     K01193.1
KEYWORDS    hygromycin B phosphotransferase.
SOURCE      Plasmid pJR225
  ORGANISM  Plasmid pJR225
            other sequences; plasmids.
REFERENCE   1  (bases 1 to 1527)
  AUTHORS   Gritz,L. and Davies,J.
  TITLE     Plasmid-encoded hygromycin B resistance: the sequence of hygromycin
            B phosphotransferase gene and its expression in Escherichia coli
            and Saccharomyces cerevisiae
  JOURNAL   Gene 25 (2-3), 179-188 (1983)
   PUBMED   6319235
COMMENT     Original source text: Plasmid pJR225 (clone: pLG62.) DNA.
            Hygromycin B resistant E.coli were found to contain a Klebsiella-
            derived plasmid, pJR225. This plasmid contains the hph gene which
            codes for hygromycin B phosphotransferase (HPH). [1] also placed
            the hph coding sequence downstream from the yeast (S.cerevisiae)
            cyc1 promoter using the hybrid vector pEX-2. Transformants
            containing the hph gene in the correct orientation with respect to
            the cyc1 promoter were hygromycin B resistant. Plasmid DNA from
            these yeast cells was able to transform E.coli cells from
            hygromycin B sensitive to hygromycin B resistant. Thus, the hph
            gene can be used in cloning vectors for both pro- and eukaryotes.
FEATURES             Location/Qualifiers
     source          1..1527
                     /organism="Plasmid pJR225"
                     /mol_type="genomic DNA"
                     /host="W677"
                     /db_xref="taxon:2581"
                     /clone="pLG62."
                     /plasmid="Plasmid pJR225"
     gene            211..1236
                     /gene="hph"
     CDS             211..1236
                     /gene="hph"
                     /codon_start=1
                     /transl_table=11
                     /product="hygromycin B phosphotransferase"
                     /protein_id="AAA92252.1"
                     /translation="MKKPELTATSVEKFLIEKFDSVSDLMQLSEGEESRAFSFDVGGR
                     GYVLRVNSCADGFYKDRYVYRHFASAALPIPEVLDIGEFSESLTYCISRRAQGVTLQD
                     LPETELPAVLQPVAEAMDAIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIADPHVY
                     HWQTVMDDTVSASVAQALDELMLWAEDCPEVRHLVHADFGSNNVLTDNGRITAVIDWS
                     EAMFGDSQYEVANIFFWRPWLACMEQQTRYFERRHPELAGSPRLRAYMLRIGLDQLYQ
                     SLVDGNFDDAAWAQGRCDAIVRSGAGTVGRTQIARRSAAVWTDGCVEVLADSGNRRPS
                     TRPRAKE"
BASE COUNT          309 a          417 c          480 g          321 t
ORIGIN      55 bp upstream of Sau3A site.
        1 gagatgacgt tggaggggca aggtcgcgct gattgctggg gcaacacgtg gagcggatcg
       61 gggattgtct ttcttcagct cgctgatgat atgctgacgc caatgccgtt tggcctccga
      121 ctaacgaaaa tcccgcattt ggacggctga tccgattggc acggcggacg gcgaatggcg
      181 gagcagacgc tcgtccgggg gcaatgagat atgaaaaagc ctgaactcac cgcgacgtct
      241 gtcgagaagt ttctgatcga aaagttcgac agcgtctccg acctgatgca gctctcggag
      301 ggcgaagaat ctcgtgcttt cagcttcgat gtaggagggc gtggatatgt cctgcgggta
      361 aatagctgcg ccgatggttt ctacaaagat cgttatgttt atcggcactt tgcatcggcc
      421 gcgctcccga ttccggaagt gcttgacatt ggggaattca gcgagagcct gacctattgc
      481 atctcccgcc gtgcacaggg tgtcacgttg caagacctgc ctgaaaccga actgcccgct
      541 gttctgcagc cggtcgcgga ggccatggat gcgatcgctg cggccgatct tagccagacg
      601 agcgggttcg gcccattcgg accgcaagga atcggtcaat acactacatg gcgtgatttc
      661 atatgcgcga ttgctgatcc ccatgtgtat cactggcaaa ctgtgatgga cgacaccgtc
      721 agtgcgtccg tcgcgcaggc tctcgatgag ctgatgcttt gggccgagga ctgccccgaa
      781 gtccggcacc tcgtgcacgc ggatttcggc tccaacaatg tcctgacgga caatggccgc
      841 ataacagcgg tcattgactg gagcgaggcg atgttcgggg attcccaata cgaggtcgcc
      901 aacatcttct tctggaggcc gtggttggct tgtatggagc agcagacgcg ctacttcgag
      961 cggaggcatc cggagcttgc aggatcgccg cggctccggg cgtatatgct ccgcattggt
     1021 cttgaccaac tctatcagag cttggttgac ggcaatttcg atgatgcagc ttgggcgcag
     1081 ggtcgatgcg acgcaatcgt ccgatccgga gccgggactg tcgggcgtac acaaatcgcc
     1141 cgcagaagcg cggccgtctg gaccgatggc tgtgtagaag tactcgccga tagtggaaac
     1201 cgacgcccca gcactcgtcc gagggcaaag gaatagagta gatgccgacc gaacaagagc
     1261 tgatttcgag aacgcctcag ccagcaactc gcgcgagcct agcaaggcaa atgcgagaga
     1321 acggccttac gcttggtggc acagttctcg tccacagttc gctaagctcg ctcggctggg
     1381 tcgcgggagg gccggtcgca gtgattcagg cccttctgga ttgtgttggt ccccagggca
     1441 cgattgtcat gcccacgcac tcgggtgatc tgactgatcc cgcagattgg agatcgccgc
     1501 ccgtgcctgc cgattgggtg cagatct
//