LOCUS       SOYLEA                  2152 bp    DNA     linear   PLN 27-APR-1993
DEFINITION  Soybean lectin (Le1) gene, complete cds.
ACCESSION   K00821 M30884
VERSION     K00821.1
KEYWORDS    lectin; transposon.
SOURCE      Glycine max (soybean)
  ORGANISM  Glycine max
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae;
            Phaseoleae; Glycine; Soja.
REFERENCE   1  (bases 1 to 2152)
  AUTHORS   Vodkin,L.O., Rhodes,P.R. and Goldberg,R.B.
  TITLE     cA lectin gene insertion has the structural features of a
            transposable element
  JOURNAL   Cell 34 (3), 1023-1031 (1983)
   PUBMED   6313203
REFERENCE   2  (bases 719 to 819)
  AUTHORS   Jofuku,K.D., Okamuro,J.K. and Goldberg,R.B.
  TITLE     Interaction of an embryo DNA binding protein with a soybean lectin
            gene upstream region
  JOURNAL   Nature 328 (6132), 734-737 (1987)
   PUBMED   3614381
COMMENT     Original source text: Soybean seed (cv. forrest and sooty) DNA.
            [1] sequenced Le1 and a naturally occurring allelic variant of Le1
            that differs only by six single-base mutations and the presence of
            a 3.4 kb transposon-like insertion in the cds. The allelic
            sequencing covered nucleotides 769-2152.
FEATURES             Location/Qualifiers
     source          1..2152
                     /organism="Glycine max"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:3847"
     variation       794
                     /note="a in Le1; c in allele"
     variation       909
                     /note="t in Le1; a in allele"
     mRNA            939..1952
                     /note="Le1 mRNA (alt.)"
     mRNA            939..1921
                     /note="Le1 mRNA (alt.)"
     CDS             969..1826
                     /note="lectin prepeptide"
                     /codon_start=1
                     /protein_id="AAA33983.1"
                     /translation="MATSKLKTQNVVVSLSLTLTLVLVLLTSKANSAETVSFSWNKFV
                     PKQPNMILQGDAIVTSSGKLQLNKVDENGTPKPSSLGRALYSTPIHIWDKETGSVASF
                     AASFNFTFYAPDTKRLADGLAFFLAPIDTKPQTHAGYLGLFNENESGDQVVAVEFDTF
                     RNSWDPPNPHIGINVNSIRSIKTTSWDLANNKVAKVLITYDASTSLLVASLVYPSQRT
                     SNILSDVVDLKTSLPEWVRIGFSAATGLDIPGESHDVLSWSFASNLPHASSNIDPLDL
                     TSFVLHEAI"
     sig_peptide     969..1064
                     /note="lectin signal peptide"
     mat_peptide     1065..1823
                     /product="lectin mature peptide"
     variation       1066
                     /note="c in Le1; t in allele"
     variation       1229
                     /note="c in Le1; g in allele"
     variation       1565..1567
                     /note="cta in Le1; cta...3.4 kb...cta in allele"
     variation       1667
                     /note="c in Le1; t in allele"
     variation       2035
                     /note="g in Le1; c in allele"
BASE COUNT          689 a          417 c          341 g          703 t
ORIGIN      416 bp upstream of HpaI site.
        1 caatgccatc gtatcgtgtc acaatggaat acagcaatga acaaatgcta tcctcttgag
       61 aaaagtgaaa tgcagcagca gcagcagact agagtgctac aaatgcttat cctcttgaga
      121 aaagtgaaat gcagcggcag cagacctgag tgctatatac aattagacac agggtctatt
      181 aattgaaatt gtcttattat taaatatttc gttttatatt aattttttaa attttaatta
      241 aatttatata tattatattt aagacagata tatttatttg tgattataaa tgtgtcactt
      301 tttcttttag tccatgtatt cttctatttt ttcaatttaa ctttttattt ttatttttaa
      361 gtcactctga tcaagaaaac attgttgaca taaaactatt aacataaaat tatgttaaca
      421 tgtgataaca tcatatttta ctaatataac gtcgcatttt aacgtttttt taacaaatat
      481 cgactgtaag agtaaaaatg aaatgtttga aaaggttaat tgcatactaa ctattttttt
      541 tcctataagt aatctttttt gggatcannt gtatatcatt gagatacgat attaaatatg
      601 ggtacctttt cacaaaacct acccttgtta gtcaaaccac acataagaga ggatggattt
      661 aaaccagtca gcaccgtaag tatatagtga agaaggctga taacacactc tattattgtt
      721 agtacgtacg tatttccttt tttgtttagt ttttgaattt aattaattaa aatatatatg
      781 ctaacaacat taaattttaa atttacgtct aattatatat tgtgatgtat aataaattgt
      841 caacctttaa aaattataaa agaaatatta attttgataa acaacttttg aaaagtaccc
      901 aataatgcta gtataaatag gggcatgact ccccatgcat cacagtgcaa tttagctgaa
      961 gcaaagcaat ggctacttca aagttgaaaa cccagaatgt ggttgtatct ctctccctaa
     1021 ccttaacctt ggtactggtg ctactgacca gcaaggcaaa ctcagcggaa actgtttctt
     1081 tcagctggaa caagttcgtg ccgaagcaac caaacatgat cctccaagga gacgctattg
     1141 tgacctcctc gggaaagtta caactcaata aggttgacga aaacggcacc ccaaaaccct
     1201 cgtctcttgg tcgcgccctc tactccaccc ccatccacat ttgggacaaa gaaaccggta
     1261 gcgttgccag cttcgccgct tccttcaact tcaccttcta tgcccctgac acaaaaaggc
     1321 ttgcagatgg gcttgccttc tttctcgcac caattgacac taagccacaa acacatgcag
     1381 gttatcttgg tcttttcaac gaaaacgagt ctggtgatca agtcgtcgct gttgagtttg
     1441 acactttccg gaactcttgg gatccaccaa atccacacat cggaattaac gtcaattcta
     1501 tcagatccat caaaacgacg tcttgggatt tggccaacaa taaagtagcc aaggttctca
     1561 ttacctatga tgcctccacc agcctcttgg ttgcttcttt ggtctaccct tcacagagaa
     1621 ccagcaatat cctctccgat gtggtcgatt tgaagacttc tcttcccgag tgggtgagga
     1681 tagggttctc tgctgccacg ggactcgaca tacctgggga atcgcatgac gtgctttctt
     1741 ggtcttttgc ttccaatttg ccacacgcta gcagtaacat tgatcctttg gatcttacaa
     1801 gctttgtgtt gcatgaggcc atctaaatgt gacagatcga aggaagaaag tgtaataaga
     1861 cgactctcac tactcgatcg ctagtgattg tcattgttat atataataat gttatctttc
     1921 acaacttatc gtaatgcatt gtgaaactat aacacattta atcctacttg tcatatgata
     1981 acactctccc catttaaaac tcttgtcaat ttaaagatat aagattcttt aaatgattaa
     2041 aaaaaatata ttataaattc aatcactcct actaataaat tattaattaa tatttattga
     2101 ttaaaaaaat acttatacta atttagtctg aatagaataa ttagattcta ga
//