LOCUS       AH001119                 505 bp    mRNA    linear   INV 19-SEP-2016
DEFINITION  Trypanosoma brucei variant surface glycoprotein 221 propeptide
            mRNA, partial cds; and VSG 221 mRNA mRNA, pre-variant surface
            glycoprotein 221 mRNA, partial cds.
ACCESSION   AH001119 J01228 K00640 K00641
VERSION     AH001119.2
KEYWORDS    antigenic variation; gene conversion; glycoprotein; surface
            glycoprotein; switching; variant surface glycoprotein; variant
            surface glycoprotein 221.
SOURCE      Trypanosoma brucei
  ORGANISM  Trypanosoma brucei
            Eukaryota; Discoba; Euglenozoa; Kinetoplastea; Metakinetoplastina;
            Trypanosomatida; Trypanosomatidae; Trypanosoma.
REFERENCE   1  (bases 346 to 505)
  AUTHORS   Majumder,H.K., Boothroyd,J.C. and Weber,H.
  TITLE     Homologous 3'-terminal regions of mRNAs for surface antigens of
            different antigenic variants of Trypanosoma brucei
  JOURNAL   Nucleic Acids Res. 9 (18), 4745-4753 (1981)
   PUBMED   6170939
REFERENCE   2  (bases 1 to 505)
  AUTHORS   Boothroyd,J.C., Paynter,C.A., Cross,G.A., Bernards,A. and Borst,P.
  TITLE     Variant surface glycoproteins of Trypanosoma brucei are synthesised
            with cleavable hydrophobic sequences at the carboxy and amino
            termini
  JOURNAL   Nucleic Acids Res. 9 (18), 4735-4743 (1981)
   PUBMED   6272213
REFERENCE   3  (bases 1 to 53)
  AUTHORS   Boothroyd,J.C. and Cross,G.A.
  TITLE     Transcripts coding for variant surface glycoproteins of Trypanosoma
            brucei have a short, identical exon at their 5' end
  JOURNAL   Gene 20 (2), 281-289 (1982)
   PUBMED   7166234
COMMENT     On or before Aug 1, 2016 this sequence version replaced K00640.1,
            K00641.1, AH001119.1.
FEATURES             Location/Qualifiers
     source          1..505
                     /organism="Trypanosoma brucei"
                     /mol_type="mRNA"
                     /db_xref="taxon:5691"
     CDS             69..>245
                     /codon_start=1
                     /product="variant surface glycoprotein 221 propeptide"
                     /protein_id="AAA30276.1"
                     /translation="MPSNQEARLFLAVLVLAQVLPILVDSAAEKGFKQAFWQPLCQVS
                     EELDDQPKGALFTLQ"
     sig_peptide     72..146
                     /note="variant surface glycoprotein 221 signal peptide"
     mat_peptide     147..>245
                     /product="variant surface glycoprotein 221 mature peptide"
     gap             246..345
                     /estimated_length=unknown
     CDS             <346..423
                     /codon_start=1
                     /product="pre-variant surface glycoprotein 221"
                     /protein_id="AAA30277.1"
                     /translation="NTNTTGSSNSFVISKTPLWLAVLLF"
     mat_peptide     <346..369
                     /product="variant surface glycoprotein 221 mature pept"
BASE COUNT           95 a          108 c           71 g          128 t
ORIGIN      5' end of mRNA.
        1 nncgctntta ttagaacagt ttctgtacta tattgattgt agttattcct acgcgacacg
       61 tacgcggcat gccttccaat caggaggccc ggcttttcct cgccgtcttg gtcctagccc
      121 aagttcttcc aattcttgtc gattcggcgg ctgaaaaagg tttcaaacaa gctttttggc
      181 aacctctttg ccaggtctcc gaggagctag acgaccaacc gaagggtgcg ttgtttacgc
      241 tgcaannnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
      301 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnaacac aaacaccaca
      361 ggaagcagca attcttttgt cattagcaag acccctcttt ggcttgcagt tttgcttttt
      421 taatttcccc cctcaaattt cccccctcct tttaaaattt tccttgctac ttgaaaactt
      481 tttgatatat tttaacacca aaacc
//