LOCUS JAFATU010000464 2450 bp DNA linear ENV 23-FEB-2023 DEFINITION MAG: Acidobacteriaceae bacterium isolate CP_BM_ER_R9_20 BM_ER_R9_k147_2563801, whole genome shotgun sequence. ACCESSION JAFATU010000464 JAFATU010000000 VERSION JAFATU010000464.1 DBLINK BioProject: PRJNA687273 BioSample: SAMN17140498 KEYWORDS WGS; ENV; Metagenome Assembled Genome; MAG. SOURCE Acidobacteriaceae bacterium (rhizosphere metagenome) ORGANISM Acidobacteriaceae bacterium Bacteria; Acidobacteriota; Terriglobia; Terriglobales; Acidobacteriaceae. REFERENCE 1 (bases 1 to 2450) AUTHORS Camargo,A.P., de Souza,R.S.C., Jose,J., Gerhardt,I.R., Dante,R.A., Mukherjee,S., Huntemann,M., Kyrpides,N.C., Carazzolle,M.F. and Arruda,P. TITLE Plant microbiomes harbor potential to promote nutrient turnover in impoverished substrates of a Brazilian biodiversity hotspot JOURNAL ISME J 17 (3), 354-370 (2023) PUBMED 36536072 REFERENCE 2 (bases 1 to 2450) AUTHORS Camargo,A.P. TITLE Direct Submission JOURNAL Submitted (28-DEC-2020) Plant Microbiome, The Genomics for Climate Change Research Center, Avenida Candido Rondon, Campinas, SP 13083-875, Brazil COMMENT The annotation was added by the NCBI Prokaryotic Genome Annotation Pipeline (PGAP). Information about PGAP can be found here: https://www.ncbi.nlm.nih.gov/genome/annotation_prok/ ##Genome-Assembly-Data-START## Assembly Method :: MEGAHIT v. 1.2.7 Genome Representation :: Full Expected Final Version :: No Genome Coverage :: 6.33755449999999x Sequencing Technology :: Illumina HiSeq ##Genome-Assembly-Data-END## ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Date :: 01/30/2021 02:46:40 Annotation Pipeline :: NCBI Prokaryotic Genome Annotation Pipeline (PGAP) Annotation Method :: Best-placed reference protein set; GeneMarkS-2+ Annotation Software revision :: 5.0 Features Annotated :: Gene; CDS; rRNA; tRNA; ncRNA; repeat_region Genes (total) :: 3,291 CDSs (total) :: 3,260 Genes (coding) :: 3,229 CDSs (with protein) :: 3,229 Genes (RNA) :: 31 tRNAs :: 30 ncRNAs :: 1 Pseudo Genes (total) :: 31 CDSs (without protein) :: 31 Pseudo Genes (ambiguous residues) :: 0 of 31 Pseudo Genes (frameshifted) :: 10 of 31 Pseudo Genes (incomplete) :: 17 of 31 Pseudo Genes (internal stop) :: 6 of 31 Pseudo Genes (multiple problems) :: 2 of 31 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..2450 /organism="Acidobacteriaceae bacterium" /mol_type="genomic DNA" /submitter_seqid="BM_ER_R9_k147_2563801" /isolate="CP_BM_ER_R9_20" /isolation_source="Rock nearby Barbacenia macrantha specimens" /db_xref="taxon:2052142" /environmental_sample /geo_loc_name="Brazil: Minas Gerais" /lat_lon="19.2822 S 43.5936 W" /collection_date="06-Mar-2017" /metagenome_source="rhizosphere metagenome" /note="metagenomic" gene complement(<1..582) /locus_tag="JO217_07985" CDS complement(<1..582) /locus_tag="JO217_07985" /inference="COORDINATES: similar to AA sequence:RefSeq:WP_013568470.1" /note="Derived by automated computational analysis using gene prediction method: Protein Homology." /codon_start=1 /transl_table=11 /product="beta-galactosidase" /protein_id="MBV9442620.1" /translation="MRATATEAGRKLTLRGTGGTVDATQGWRIHLKTGTAVSISQFQI VGSRRVRFDYISIVVPIKSVLRFRSSGFRRFAGVLVLALTYVSGSAAVEAPRIIEKDA HYALLVDGKPFLILGGQIHNSSGWPGELPQVWTSMETLHANTIEAPIYWEQFEPEPGK FDYTNVDAIVNGARAHKLRVVLLWFGTWKNGNMH" gene 643..2114 /locus_tag="JO217_07990" /pseudo CDS 643..2114 /locus_tag="JO217_07990" /inference="COORDINATES: similar to AA sequence:RefSeq:WP_020712355.1" /note="frameshifted; internal stop; Derived by automated computational analysis using gene prediction method: Protein Homology." /pseudo /codon_start=1 /transl_table=11 /product="DUF3300 domain-containing protein" gene 2155..>2450 /locus_tag="JO217_07995" CDS 2155..>2450 /locus_tag="JO217_07995" /inference="COORDINATES: similar to AA sequence:RefSeq:WP_020710489.1" /note="Derived by automated computational analysis using gene prediction method: Protein Homology." /codon_start=1 /transl_table=11 /product="DUF2950 family protein" /protein_id="MBV9442621.1" /translation="MKWPSANRKFSRRACTLSVAAWTCLSCSALFAAQESAAKAPPKP APAPSIQARLFNTPQQAADALIDAAEKFDEGALTKIFGPDGDDVVFTGEYPQDR" BASE COUNT 516 a 686 c 754 g 494 t ORIGIN 1 atgcatgttg ccgtttttcc atgtgccgaa ccacagcaga acgacacgca gcttatgtgc 61 ccgggctccg ttcacaatcg catccacgtt ggtgtaatcg aatttccccg gttcaggttc 121 gaactgctcc caatagattg gggcctcaat cgtattcgca tgaagggttt ccatcgaagt 181 ccatacctgg ggtaactcgc ccggccatcc gcttgagttg tgaatctgac caccaaggat 241 caggaatggt ttgccgtcta ccaggagcgc ataatgcgcg tccttttcga tgattcgggg 301 tgcctcaaca gccgcgctgc cggaaacata tgtcagggcg agcaccagca cccctgcaaa 361 tcttctgaaa cctgaactgc ggaagcgtag tacggatttg atcgggacca caatagaaat 421 gtaatcgaat cggactcggc gcgagccgac gatctgaaat tgtgagatcg aaacggctgt 481 tcccgtcttt aaatgaatcc gccaaccctg ggtcgcatcg actgttccgc cggtaccgcg 541 caacgttagt tttcgaccag cttcggtcgc ggtggcccgc atgcagtcag agaatacacg 601 cgtatgagag tccagatgaa gggcggaaca ttcagatctg taatggcggt ttcgtgtgcc 661 cttgcgctcg tgccaggaaa tgctctgtcc tatcctttac aacagtcatc cgcgaagcca 721 ccgaacaaat ccgcggcgca gccgggccaa gtcgccaaga ttccgccgga acaactcgat 781 tcactcgtcg cgccgattgc cctgtatccc gacccgttgt tggcccagat cttagcagcg 841 tctacctatc ctctcgaaat catattgctc cagcaatagc tggacaagaa caaggatttg 901 aaggacaaag cgcttgccga tgccgcagca aagcagccgt gggatgcgag cgttcaggct 961 cttacgcctc tgccgcaggt ggtgaaactc ctggcagata acattcagtg gacgaccgat 1021 ctgggcaatg ctttcctggc gcagcaggct gacgtcatgg atgccgtgca gcgaatgcgt 1081 aagaaagccc aggaaaaagg caacctgaaa accaacgagc agcaaaaggt agaaaccacc 1141 gtagtccaga acaaaacggt tatcgtggtc gagccttcca agccggacgt gatctacgtg 1201 ccttcgtacg accccgttgt ggtttacgga gctccctatt atccatatcc tccgatttac 1261 tatccgccct ggccctatta cgctgccggt gctgcgattt cttttggctt cggggtgatg 1321 tgggcgcgtt ctggagcggt ggttggggct ggggctgcgg ctggagcaac aacaacatct 1381 acatcaacaa caataataat ttcaatcgga ccagcaatat cggaaacggc aatcgcgtga 1441 atcctttatc gtctcgcggg ggcgttggcg gcgttggcgg cgttggcggt gtcggtggag 1501 ttggaggtgc tggcggagtg ggtggccctg gaggagtggg cagtgctggt ggcatcggtg 1561 gacccggtgg agtcgggggc gtcggcggag tgggcagtgc tggtggggtt ggcggactcg 1621 gtggtgctgg cggggtcgga aacggcggca gcaactggag ccacaacccg gaacatcgcg 1681 gcggcgcacc gtatcgtgat cgtgcgaccg cggaccgatt tggcggaaat gcccgtggcg 1741 attcgctcgc ccggcgccaa tccactgcgc gtcaacagat agcccggcag ggcggaaatg 1801 tatcgagcaa ccttggttcc ggtaacggtt tcggcaatcg cggcgacaat tccgtactcg 1861 gcaaccgcag cggcgccgga agtggcggct ctgctttggg cggcggccgg acgggcggcc 1921 gcagtggcga tagcatcggt agccgcgatc tatcccgcgc aggcggcgga aaccgggacg 1981 cgttcagcgg cggtgccaga ggctatgacg gatcgagggc gcgtagcagc agcagccgcg 2041 gctcttccag ccttgggtct cgcagcggcg gaggaggcat gagccgtggt ggcggtggcg 2101 gccggcgcca atagccggaa cggatcccag caacgaagcg agaggaaaat caatatgaaa 2161 tggccatcag cgaataggaa attttctcgc cgcgcgtgca ctctgagtgt ggccgcctgg 2221 acttgtctct cctgttcggc cctgtttgcg gcacaggagt ctgccgctaa agcgcccccc 2281 aagcctgcac ctgctccttc tatacaagcg cggctgttca acactccgca gcaggccgcg 2341 gacgcgctta tcgatgctgc cgaaaaattc gacgaaggtg ctttgacaaa gatctttggt 2401 cccgatggcg acgatgtcgt cttcactggc gaatacccgc aagaccggaa //