LOCUS       RATWAP                   548 bp    mRNA    linear   ROD 27-APR-1993
DEFINITION  rat whey acidic protein mrna.
ACCESSION   J00801
VERSION     J00801.1
KEYWORDS    whey acidic protein.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 548)
  AUTHORS   Hennighausen,L.G., Sippel,A.E., Hobbs,A.A. and Rosen,J.M.
  TITLE     Comparative sequence analysis of the mRNAs coding for mouse and rat
            whey protein
  JOURNAL   Nucleic Acids Res. 10 (12), 3733-3744 (1982)
   PUBMED   6896749
COMMENT     Original source text: rat cdna to mrna.
            whey acidic protein (wap) is a major milk protein found in mouse
            and rat. comparison of the rat and mouse waps (see muswap) show
            that the signal peptide and the first cysteine domain are conserved
            to a greater extent than the rest of the protein. the 3' noncoding
            regions show a 91% conservation which is half the substitution rate
            for the coding protein, indicating a possible functional importance
            for this region. this sequence differs at twelve sites from
            ratwap52 which may be an allelic variant. see ratwap52.
FEATURES             Location/Qualifiers
     source          1..548
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
     mRNA            <1..548
                     /product="ratwap mRNA"
     CDS             3..416
                     /note="whey acidic protein"
                     /codon_start=1
                     /protein_id="AAA42346.1"
                     /translation="MRCSISLVLGLLALEVALARNLQEHVFNSVQSMCPDDSSSEDTE
                     CIKCQTNEECAQNDMCCPSSCGRPCKTPVNIEVQKAGRCPWNPIQMIAAGPCPKGNPC
                     SIDSDCSGTMKCCNNGCIMSCMDPKPDSPTVISFQ"
     sig_peptide     6..59
                     /note="signal peptide"
BASE COUNT          137 a          152 c          128 g          131 t
ORIGIN      41 bases upstream from avaii site.
        1 ccatgcgctg ttcgatcagc ctcgttcttg gcctgctggc cctggaggta gcccttgctc
       61 ggaacctaca ggaacatgtc ttcaactcag ttcagtccat gtgccctgat gacagctcca
      121 gtgaggacac agaatgtatc aagtgtcaaa ccaacgagga gtgtgcccag aatgacatgt
      181 gttgtcccag ttcctgtggt aggccctgca aaactcctgt caacattgag gttcaaaagg
      241 ctggccgctg cccctggaat ccaatccaga tgatcgctgc tggaccatgc ccaaagggca
      301 acccatgctc catcgacagt gattgttctg gcaccatgaa atgctgcaac aatggctgta
      361 tcatgagttg tatggaccca aaaccagatt ctcctacagt gatatccttt cagtgagaag
      421 cctgccctgg gatccctgcc tgtcaggagt gaccagccca agcctgtaca gcaagaacct
      481 tcactcttgg atccagagag aacataatgc tttctaaccg ctgctaataa aaatccattt
      541 gggcttta
//