LOCUS HUMPLB 792 bp mRNA linear HUM 29-APR-1996 DEFINITION Human placental lactogen hormone (PL-4) mRNA, complete cds. ACCESSION J00118 VERSION J00118.1 KEYWORDS lactogen; somatomammotropin. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 507 to 730) AUTHORS Seeburg,P.H., Shine,J., Martial,J.A., Ullrich,A., Baxter,J.D. and Goodman,H.M. TITLE Nucleotide sequence of part of the gene for human chorionic somatomammotropin: purification of DNA complementary to predominant mRNA species JOURNAL Cell 12 (1), 157-165 (1977) PUBMED 71212 REFERENCE 2 (bases 176 to 730) AUTHORS Shine,J., Seeburg,P.H., Martial,J.A., Baxter,J.D. and Goodman,H.M. TITLE Construction and analysis of recombinant DNA for human chorionic somatomammotropin JOURNAL Nature 270 (5637), 494-499 (1977) PUBMED 593368 REFERENCE 3 (bases 1 to 792) AUTHORS Seeburg,P.H. TITLE The human growth hormone gene family: nucleotide sequences show recent divergence and predict a new polypeptide hormone JOURNAL DNA 1 (3), 239-249 (1982) PUBMED 7169009 COMMENT Original source text: Homo sapiens placenta cDNA to mRNA. hpl-4 is one of four non-allelic human placental lactogen genes (also known as chorionic somatomammotropin genes). The hpl-1 and hpl-2 genes are probably not transcribed because restriction enzyme analysis of placental mRNA fails to detect the fragments predicted by these genes [1]. hpl-3 is transcribed and information from two alleles coding for it has been sequenced . hpl genes are closely related to human growth hormone (hgh) genes. See loci beginning . FEATURES Location/Qualifiers source 1..792 /db_xref="H-InvDB:HIT000191042" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /map="17q22-q24" /tissue_type="placenta" gene 1..792 /gene="CSH1" mRNA <1..792 /gene="CSH1" /note="G00-119-084" CDS 30..683 /gene="CSH1" /codon_start=1 /product="placental lactogen" /protein_id="AAA98621.1" /db_xref="GDB:G00-119-084" /translation="MAPGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAH RAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELL RISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRR TGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF" sig_peptide 30..107 /gene="CSH1" /note="G00-119-084" mat_peptide 108..680 /gene="CSH1" /product="placental lactogen" /note="G00-119-084" regulatory 769..774 /regulatory_class="polyA_signal_sequence" /gene="CSH1" /note="G00-119-084" BASE COUNT 174 a 252 c 195 g 171 t ORIGIN 170bp 5' to PvuII. 1 gggtcctgtg gacagctcac ctagtggcaa tggctccagg ctcccggacg tccctgctcc 61 tggcttttgc cctgctctgc ctgccctggc ttcaagaggc tggtgccgtc caaaccgttc 121 cgttatccag gctttttgac cacgctatgc tccaagccca tcgcgcgcac cagctggcca 181 ttgacaccta ccaggagttt gaagaaacct atatcccaaa ggaccagaag tattcgttcc 241 tgcatgactc ccagacctcc ttctgcttct cagactctat tccgacaccc tccaacatgg 301 aggaaacgca acagaaatcc aatctagagc tgctccgcat ctccctgctg ctcatcgagt 361 cgtggctgga gcccgtgcgg ttcctcagga gtatgttcgc caacaacctg gtgtatgaca 421 cctcggacag cgatgactat cacctcctaa aggacctaga ggaaggcatc caaacgctga 481 tggggaggct ggaagacggc agccgccgga ctgggcagat cctcaagcag acctacagca 541 agtttgacac aaactcgcac aaccatgacg cactgctcaa gaactacggg ctgctctact 601 gcttcaggaa ggacatggac aaggtcgaga cattcctgcg catggtgcag tgccgctctg 661 tggagggcag ctgtggcttc taggtgcccg agtagcatcc tgtgacccct ccccagtgcc 721 tctcctggcc cctgaaggtg ccactccagt gcccaccagc cttgtcctaa taaaattaag 781 ttgtatcatt tc //