LOCUS       HQ909994                 195 bp    DNA     linear   PLN 08-JUN-2012
DEFINITION  Blastocystis sp. subtype 3 isolate MA46 ribosomal protein S3 (rps3)
            gene, partial cds; mitochondrial.
ACCESSION   HQ909994
VERSION     HQ909994.1
KEYWORDS    .
SOURCE      mitochondrion Blastocystis sp. subtype 3
  ORGANISM  Blastocystis sp. subtype 3
            Eukaryota; Sar; Stramenopiles; Bigyra; Opalozoa; Opalinata;
            Blastocystidae; Blastocystis.
REFERENCE   1  (bases 1 to 195)
  AUTHORS   Stensvold,C.R. and Clark,C.G.
  TITLE     Investigation of the molecular epidemiology of Blastocystis by use
            of a multi-locus sequence typing system for subtype 3
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 195)
  AUTHORS   Stensvold,C.R. and Clark,C.G.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-JAN-2011) Department of Microbiological Diagnostics,
            Statens Serum Institut, Artillerivej 5, Copenhagen DK-2300 S,
            Denmark
FEATURES             Location/Qualifiers
     source          1..195
                     /organism="Blastocystis sp. subtype 3"
                     /organelle="mitochondrion"
                     /mol_type="genomic DNA"
                     /isolate="MA46"
                     /host="Homo sapiens"
                     /db_xref="taxon:944168"
                     /note="subtype: 3"
     gene            <1..>195
                     /gene="rps3"
     CDS             <1..>195
                     /gene="rps3"
                     /codon_start=1
                     /product="ribosomal protein S3"
                     /protein_id="AEX97284.1"
                     /translation="LLVNKYLPLVSFKTYSLNLLKANYTFKFNFLKQTNQIKTNHYNV
                     VLKTNEKKIRKFRYTKFNRYS"
BASE COUNT           89 a           16 c           10 g           80 t
ORIGIN      
        1 ttattagtta ataaatattt acctttagtt agttttaaaa cttattcttt aaatttatta
       61 aaagcaaatt atacttttaa atttaatttt ttaaaacaaa ctaatcaaat taaaactaat
      121 cattataatg tagttttaaa aacaaatgaa aaaaaaattc gtaaatttag atatactaaa
      181 tttaatcgat attca
//