LOCUS       HQ161710                 342 bp    DNA     linear   INV 25-JUL-2016
DEFINITION  Drosophila ficusphila strain 14025-0441.00 Rieske iron-sulfur
            protein (RFeSP) gene, partial cds.
ACCESSION   HQ161710
VERSION     HQ161710.1
KEYWORDS    .
SOURCE      Drosophila ficusphila
  ORGANISM  Drosophila ficusphila
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
REFERENCE   1  (bases 1 to 342)
  AUTHORS   Gontijo,A.M., Miguela,V., Whiting,M.F., Woodruff,R.C. and
            Dominguez,M.
  TITLE     Intron retention in the Drosophila melanogaster Rieske iron sulphur
            protein gene generated a new protein
  JOURNAL   Nat Commun 2, 323 (2011)
   PUBMED   21610726
REFERENCE   2  (bases 1 to 342)
  AUTHORS   Gontijo,A.M., Miguela,V., Whiting,M.F., Woodruff,R.C. and
            Dominguez,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (19-AUG-2010) Unidad de Neurobiologia del Desarrollo,
            Instituto de Neurociencias, CSIC-UMH, Avda. Ramon y Cajal, s/n.,
            03550 Sant Joan d'Alacant, Alicante 03550, Spain
FEATURES             Location/Qualifiers
     source          1..342
                     /organism="Drosophila ficusphila"
                     /mol_type="genomic DNA"
                     /strain="14025-0441.00"
                     /db_xref="taxon:30025"
     gene            <1..>342
                     /gene="RFeSP"
     mRNA            join(<1..39,105..>323)
                     /gene="RFeSP"
                     /product="Rieske iron-sulfur protein"
     CDS             join(<1..39,105..323)
                     /gene="RFeSP"
                     /codon_start=1
                     /product="Rieske iron-sulfur protein"
                     /protein_id="AEF97515.1"
                     /translation="VATSTLRDPEADDQRVVKPEWLVVIGVCTHLGCVPIANAGDWGG
                     YYCPCHGSHYDASGRIRKGPAPLNLEVPTHEFPNEGLLIVG"
BASE COUNT           72 a           98 c           90 g           82 t
ORIGIN      
        1 gtggccacat ccactctgcg cgatcccgaa gctgatgatg taagtagata tcttcattag
       61 gaaaatcaat ataatttact aatatttccg ttcgaatcct gcagcaacgt gtggtcaagc
      121 ccgaatggct ggtggtcatc ggtgtgtgca cgcatctggg ttgtgtgccc atcgcgaacg
      181 ccggtgactg gggcggctac tactgcccct gccacggttc ccactacgac gcctctggac
      241 gcatccgcaa gggtccggcg ccacttaatc tggaagtgcc cacccacgag ttccccaacg
      301 agggcctcct cattgtcggc tagaggagct gttatcgttt aa
//