LOCUS       GU348525                 753 bp    DNA     linear   PLN 01-SEP-2010
DEFINITION  Arabidopsis thaliana ecotype Bur-0 indole-3-acetic acid inducible 2
            (IAA2) gene, complete cds.
ACCESSION   GU348525
VERSION     GU348525.2
KEYWORDS    .
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 753)
  AUTHORS   Delker,C., Poschl,Y., Raschke,A., Ullrich,K., Ettingshausen,S.,
            Hauptmann,V., Grosse,I. and Quint,M.
  TITLE     Natural variation of transcriptional auxin response networks in
            Arabidopsis thaliana
  JOURNAL   Plant Cell 22 (7), 2184-2200 (2010)
   PUBMED   20622145
REFERENCE   2  (bases 1 to 753)
  AUTHORS   Delker,C., Quint,M. and Ullrich,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-DEC-2009) Stress and Developmental Biology, Leibniz
            Institute of Plant Biochemistry, Weinberg 3, Halle 06120, Germany
REFERENCE   3  (bases 1 to 753)
  AUTHORS   Delker,C., Quint,M. and Ullrich,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-JUN-2010) Stress and Developmental Biology, Leibniz
            Institute of Plant Biochemistry, Weinberg 3, Halle 06120, Germany
  REMARK    Sequence update by submitter
COMMENT     On Jun 4, 2010 this sequence version replaced GU348525.1.
FEATURES             Location/Qualifiers
     source          1..753
                     /organism="Arabidopsis thaliana"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:3702"
                     /ecotype="Bur-0"
     gene            <1..>753
                     /gene="IAA2"
                     /locus_tag="AT3G23030"
     mRNA            join(<1..226,319..>753)
                     /gene="IAA2"
                     /locus_tag="AT3G23030"
                     /product="indole-3-acetic acid inducible 2"
     5'UTR           <1..53
                     /gene="IAA2"
                     /locus_tag="AT3G23030"
     CDS             join(54..226,319..670)
                     /gene="IAA2"
                     /locus_tag="AT3G23030"
                     /codon_start=1
                     /product="indole-3-acetic acid inducible 2"
                     /protein_id="ADC29360.1"
                     /translation="MAYEKVNELNLKDTELCLGLPGRTEKIKEEQEVSCVKSNNKRLF
                     EETRDEEESTPPTKTQIVGWPPVRSSRKNNNSVSYVKVSMDGAPYLRKIDLKTYKNYP
                     ELLKALENMFKVMIGEYCEREGYKGSGFVPTYEDKDGDWMLVGDVPWDMFSSSCKRLR
                     IMKGSDAPALDSSL"
     3'UTR           671..>753
                     /gene="IAA2"
                     /locus_tag="AT3G23030"
BASE COUNT          253 a          138 c          164 g          198 t
ORIGIN      
        1 cccaagaaaa cacacaagaa ggaaacacaa agattgatat tgatccaaaa gcaatggcgt
       61 acgagaaagt caacgagctt aaccttaagg acacagagct atgtcttgga ttacccggaa
      121 gaacagagaa gatcaaagaa gaacaagagg tttcttgcgt taaaagtaac aacaagcgtc
      181 tatttgagga aactcgtgat gaagaagaat ctacacctcc taccaagtaa gtagaagaga
      241 tctgagtttc aaattggctt ctttcaaatt attggctctt gaatagtttt actaatcttt
      301 ctttcctcaa atttacagaa ctcaaatcgt tggttggcca ccagtgagat cttcccgtaa
      361 gaacaacaac agtgtgagct acgtgaaagt gagtatggac ggagctcctt accttcgcaa
      421 gatcgatctc aagacataca aaaactaccc cgagcttctc aaagcgttag agaatatgtt
      481 caaagtcatg attggtgaat attgtgagag agaaggatac aaaggatcag gatttgtacc
      541 aacatacgaa gataaagatg gtgactggat gttggttggt gatgttccat gggacatgtt
      601 ctcttcttct tgtaagagac tcagaatcat gaagggatcc gacgctcctg ctctagactc
      661 ttccttatga tccagagaag ctgtgaatct tttgtctaaa aaggagatga tgactatgat
      721 cgatgaatga aaaacccttt ttggtttgat tcg
//