LOCUS       GABD01009600            1676 bp    mRNA    linear   TSA 31-OCT-2012
DEFINITION  TSA: Pan troglodytes Chimpanzee_0098511 mRNA sequence.
ACCESSION   GABD01009600
VERSION     GABD01009600.1
DBLINK      BioProject: PRJNA173089
            Sequence Read Archive: SRR544870
KEYWORDS    TSA; Transcriptome Shotgun Assembly.
SOURCE      Pan troglodytes (chimpanzee)
  ORGANISM  Pan troglodytes
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Pan.
REFERENCE   1  (bases 1 to 1676)
  AUTHORS   Maudhoo,M.D., Meehan,D.T. and Norgren,R.B. Jr.
  TITLE     De novo assembly of the reference chimpanzee transcriptome from
            NextGen mRNA sequences
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 1676)
  AUTHORS   Maudhoo,M.D., Meehan,D.T. and Norgren,R.B. Jr.
  TITLE     Direct Submission
  JOURNAL   Submitted (15-OCT-2012) Genetics, Cell Biology and Anatomy,
            University of Nebraska Medical Center, 985805 Nebraska Medical
            Center, Omaha, NE 68198-5805, USA
COMMENT     Paired-end, 101 bp sequencing was performed on the Illumina
            platform. All reads were aligned with the human RefSeq mRNA
            transcripts using BLAST. Any reads with an alignment length
            difference with respect to the human reference sequence of 2 or
            greater were removed prior to assembly. For a given pair of reads,
            if one sequence was filtered, its pair was also filtered. Velveth
            was performed as recommended. kmer was set at 31. The output files
            from Velveth were passed to Velvetg. After performing Velvetg, this
            output file was passed to Oases where the final assembly was
            performed. Default parameters were used for Velvetg and Oases.
            
            ##Assembly-Data-START##
            Assembly Method       :: Velvet 1.2.07; Oases 0.2.08
            Sequencing Technology :: Illumina HiSeq
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..1676
                     /organism="Pan troglodytes"
                     /mol_type="mRNA"
                     /isolation_source="Clint"
                     /db_xref="taxon:9598"
                     /cell_line="untransformed fibroblast cells"
                     /tissue_type="skin"
     gene            1..1676
                     /gene="SS18L1"
     CDS             41..1231
                     /gene="SS18L1"
                     /codon_start=1
                     /product="synovial sarcoma translocation gene on
                     chromosome 18-like 1"
                     /protein_id="JAA23500.1"
                     /db_xref="GI:410289800"
                     /translation="MSVAFASARPRGKGEVTQQTIQKMLDENHHLIQCILEYQSKGKT
                     AECTQYQQILHRNLVYLATIADSNQNMQSLLPAPPTQNMNLGPGALTQSGSSQGLHSQ
                     GSLSDAISTGLPPSSLLQGQIGNGPSHVSMQQTAPNTLPTTSMSISGPGYSHAGPASQ
                     GVPMQGQGTIGNYVSRTNINMQSNPVSMMQQQAATSHYSSAQGGSQHYQGQSSIAMMG
                     QGSQGSSMMGQRPMAPYRPSQQGSSQQYLGQEEYYGEQYSHSQGAAEPMGQQYYPDGH
                     GDYAYQQSSYTEQSYDRSFEESTQHYYEGGNSQYSQQQAGYQQGAAQQQTYSQQQYPS
                     QQSYPGQQQGYGPAQGAPSQYPGYQQGQGQQYGSYRAPQTAPSAQQQRPYGYEQGQYG
                     NYQQ"
BASE COUNT          355 a          553 c          484 g          284 t
ORIGIN      
        1 tccacctcga tgaccacggg ctgagccccg cgccgccacc atgtccgtgg ccttcgcgtc
       61 tgcccggcca agaggcaaag gggaggttac gcagcaaacc atccagaaga tgctggacga
      121 gaaccaccac ctgatccagt gcatcctgga gtaccagagc aagggcaaga cggccgagtg
      181 cacgcagtac cagcagatcc tgcaccggaa cctggtatac ctggccacga tcgcagactc
      241 caaccagaac atgcagtccc tgcttcctgc cccgcccacg cagaacatga acctgggccc
      301 tggagccctg actcagagcg gctccagcca gggcctgcac tctcagggca gcctgagtga
      361 cgccatcagc acgggcctgc caccttcctc cctcctgcag ggccagattg gcaacgggcc
      421 gagccacgtg tccatgcagc agacggcgcc taacacgctg cccaccacct ccatgagcat
      481 ctctgggccc ggctacagcc acgcgggacc cgcctcgcag ggcgtcccca tgcaggggca
      541 aggcaccatc ggcaactacg tgtctcggac caacatcaac atgcagtcca acccagtctc
      601 catgatgcag cagcaggcgg ccacgtcgca ctacagctcg gcgcagggcg gcagccagca
      661 ctaccagggc cagtcgtcca tcgccatgat ggggcagggc agccagggga gcagcatgat
      721 ggggcagcgg cccatggcgc cctaccggcc ctcccagcaa ggctcttccc agcagtacct
      781 gggccaggag gagtactatg gcgagcagta cagccacagc cagggcgccg cggagcccat
      841 gggccagcag tactaccccg acggccacgg cgattacgcc taccagcagt catcctacac
      901 ggagcagagc tacgaccggt cctttgagga gtccacgcag cactactatg aggggggaaa
      961 ctcccagtac agccagcagc aggccgggta ccagcagggt gccgcgcagc agcagacgta
     1021 ctcccagcag cagtacccca gccagcagag ctaccccggg cagcagcagg gctacgggcc
     1081 tgcccaggga gccccatcac agtaccccgg ctaccagcaa ggccaaggcc agcagtacgg
     1141 aagctaccga gcaccgcaga cagcgccgtc tgcccagcag cagcggccct acggctatga
     1201 acagggccag tatggaaatt accagcagta agggacacac attctggctg gagcccttgt
     1261 ggtagcgtgt tcatccaggg gccggatggg ctggcggcag ctctggtgaa ttgtgacatg
     1321 ttggttacct gttcgcccag tgccacgtct gcatgtgaag cgtgctcatt tcatgctggg
     1381 tatgacgccg agcgcacacc actggcgtga gacagcgctt ggtggtgtga tacttttggt
     1441 gctgtgtata gtattgtatg tcggtacacg gagaggtatc ctttttttgt cccccgcccc
     1501 cttctcaatg tttctagcta gctttggggg tcattttgtc atcagagcat tctgtgccca
     1561 gggacaggac agatctcaag gacaccacag tccacctgtt cccgtcaaca gaccttaggt
     1621 ctcattttcc tcctcatgca gtgttgtagt gtgggttgtc aacttttctt taactg
//