LOCUS       FM210553                 444 bp    DNA     linear   VRL 24-NOV-2009
DEFINITION  Human Adenovirus 44 fibershaft.
ACCESSION   FM210553
VERSION     FM210553.1
KEYWORDS    .
SOURCE      Human adenovirus 44
  ORGANISM  Human adenovirus 44
            Viruses; Adenoviridae; Mastadenovirus; Human mastadenovirus D.
REFERENCE   1  (bases 1 to 444)
  AUTHORS   Darr S.
  JOURNAL   Submitted (10-SEP-2008) to the INSDC. Darr S., Institute of
            Virology, Hannover Medical School, Carl-Neuberg-Strasse 1,
            Hannover, 30625, GERMANY.
REFERENCE   2
  AUTHORS   Darr S., Madisch I., Hofmayer S., Rehren F., Heim A.
  TITLE     Phylogeny and primary structure analysis of fiber shafts of all
            human adenovirus types for rational design of adenoviral
            gene-therapy vectors
  JOURNAL   J. Gen. Virol. 90(Pt 12), 2849-2854(2009).
   PUBMED   19656960
FEATURES             Location/Qualifiers
     source          1..444
                     /organism="Human adenovirus 44"
                     /lab_host="A549 Human lung carcinoma cell line"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:46939"
     CDS             <1..>444
                     /codon_start=1
                     /gene="fibershaft"
                     /product="fiber protein"
                     /db_xref="GOA:C8Z276"
                     /db_xref="InterPro:IPR000931"
                     /db_xref="InterPro:IPR000939"
                     /db_xref="InterPro:IPR009013"
                     /db_xref="UniProtKB/TrEMBL:C8Z276"
                     /protein_id="CAR66129.1"
                     /translation="GVLSLKLADPITITNGNVSLKVGGGLTVQEGTGDLKVNAKSPLQ
                     VGTNKQLEIALANPFEEKDGKLALKIGHGLTVVDENHTHLQSLIGTLVILTGKGIGNE
                     ELKNDDGSNKGVGLCVRIGEGGGLTFDDKGYLVAWNNKHDIRTLWT"
BASE COUNT          146 a           73 c          111 g          114 t
ORIGIN      
        1 ggggtcctgt cactcaaact ggctgaccca atcaccatca ccaatgggaa tgtctcactc
       61 aaggtgggag gggggctcac tgtgcaagaa ggaactgggg acctaaaggt gaacgctaag
      121 tcccccttgc aagttggaac taataaacag ttggagattg cacttgctaa tccatttgag
      181 gaaaaggatg gcaaacttgc tttaaaaatt ggacatggat taaccgttgt ggatgaaaat
      241 catactcact tacaatcact aataggtaca cttgttattt taactggcaa gggaattggt
      301 aatgaagaat taaaaaatga cgatggtagc aataaaggag tcggtttatg tgtgagaatt
      361 ggagaaggag gtggtttaac ttttgatgat aaaggttatt tagtagcatg gaacaataaa
      421 catgacatcc gcacactttg gaca
//