LOCUS       FJ970793                 375 bp    DNA     linear   PHG 01-MAR-2010
DEFINITION  Vibrio phage CTX type El Tor cholera toxin B subunit (ctxB) gene,
            complete cds.
ACCESSION   FJ970793
VERSION     FJ970793.1
KEYWORDS    .
SOURCE      Affertcholeramvirus CTXphi
  ORGANISM  Affertcholeramvirus CTXphi
            Viruses; Monodnaviria; Loebvirae; Hofneiviricota; Faserviricetes;
            Tubulavirales; Inoviridae; Affertcholeramvirus.
REFERENCE   1  (bases 1 to 375)
  AUTHORS   Mantri,C.K., Mohapatra,S.S., Colwell,R.R. and Singh,D.V.
  TITLE     Sequence analysis of Vibrio cholerae orfU and zot from pre-CTXPhi
            and CTXPhi reveals multiple origin of pre-CTXPhi and CTXPhi
  JOURNAL   Environ Microbiol Rep 2 (1), 67-75 (2010)
   PUBMED   23766000
REFERENCE   2  (bases 1 to 375)
  AUTHORS   Mantri,C.K., Mohapatra,S.S., Colwell,R.R. and Singh,D.V.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-APR-2009) Infectious Disease Biology, Institute of
            Life Sciences, Nalco Square, Bhubaneswar, Orissa 751023, India
FEATURES             Location/Qualifiers
     source          1..375
                     /organism="Affertcholeramvirus CTXphi"
                     /mol_type="genomic DNA"
                     /host="Vibrio cholerae strain VO107 serogroup O1"
                     /db_xref="taxon:141904"
                     /note="type: El Tor"
     gene            1..375
                     /gene="ctxB"
     CDS             1..375
                     /gene="ctxB"
                     /codon_start=1
                     /transl_table=11
                     /product="cholera toxin B subunit"
                     /protein_id="ACY79017.1"
                     /translation="MIKLKFGVFFTVLLSSAYAHGTPQNITDLCAEYHNTQIYTLNDK
                     IFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAK
                     VEKLCVWNNKTPHAIAAISMAN"
BASE COUNT          141 a           56 c           67 g          111 t
ORIGIN      
        1 atgattaaat taaaatttgg tgtttttttt acagttttac tatcttcagc atatgcacat
       61 ggaacacctc aaaatattac tgatttgtgt gcagaatacc acaacacaca aatatatacg
      121 ctaaatgata agatattttc gtatacagaa tctctagctg gaaaaagaga gatggctatc
      181 attactttta agaatggtgc aacttttcaa gtagaagtac caggtagtca acatatagat
      241 tcacaaaaaa aagcgattga aaggatgaag gataccctga ggattgcata tcttactgaa
      301 gctaaagtcg aaaagttatg tgtatggaat aataaaacgc ctcatgcgat tgccgcaatt
      361 agtatggcaa attaa
//