LOCUS       EU421714                2127 bp    DNA     linear   HUM 16-FEB-2008
DEFINITION  Homo sapiens chorionic somatomammotropin hormone 1 precursor (CSH1)
            gene, complete cds, alternatively spliced.
ACCESSION   EU421714
VERSION     EU421714.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2127)
  AUTHORS   Sedman,L., Padhukasahasram,B., Kelgo,P. and Laan,M.
  TITLE     Complex signatures of locus-specific selective pressures and gene
            conversion on Human Growth Hormone/Chorionic Somatomammotropin
            genes
  JOURNAL   Hum. Mutat. 29 (10), 1181-1193 (2008)
   PUBMED   18473352
REFERENCE   2  (bases 1 to 2127)
  AUTHORS   Sedman,L., Kelgo,P. and Laan,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (23-JAN-2008) Institute of Molecular and Cell Biology,
            Tartu University, Riia 23, Tartu 51010, Estonia
FEATURES             Location/Qualifiers
     source          1..2127
                     /organism="Homo sapiens"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:9606"
                     /chromosome="17"
                     /map="17q22-q24"
     gene            333..2047
                     /gene="CSH1"
     mRNA            join(333..461,728..888,1113..1232,1326..2047)
                     /gene="CSH1"
                     /product="chorionic somatomammotropin hormone 1 isoform 2
                     precursor"
     mRNA            join(333..461,728..888,1113..1232,1326..1490,1744..2047)
                     /gene="CSH1"
                     /product="chorionic somatomammotropin hormone 1 isoform 1
                     precursor"
     mRNA            join(333..461,728..888,1744..2047)
                     /gene="CSH1"
                     /product="chorionic somatomammotropin hormone 1 isoform 3
                     precursor"
     CDS             join(452..461,728..888,1113..1232,1326..1490,1744..1941)
                     /gene="CSH1"
                     /note="PL; CSA; CSMT; alternatively spliced"
                     /codon_start=1
                     /product="chorionic somatomammotropin hormone 1 isoform 1
                     precursor"
                     /protein_id="ABZ88716.1"
                     /translation="MAPGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAH
                     RAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELL
                     RISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRR
                     TGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF"
     CDS             join(452..461,728..888,1744..1941)
                     /gene="CSH1"
                     /note="PL; CSA; CSMT; alternatively spliced"
                     /codon_start=1
                     /product="chorionic somatomammotropin hormone 1 isoform 3
                     precursor"
                     /protein_id="ABZ88718.1"
                     /translation="MAPGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAH
                     RAHQLAIDTYQEFRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMD
                     KVETFLRMVQCRSVEGSCGF"
     CDS             join(452..461,728..888,1113..1232,1326..1805)
                     /gene="CSH1"
                     /note="PL; CSA; CSMT; alternatively spliced"
                     /codon_start=1
                     /product="chorionic somatomammotropin hormone 1 isoform 2
                     precursor"
                     /protein_id="ABZ88717.1"
                     /translation="MAPGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAH
                     RAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELL
                     RISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGVRVAPGVT
                     NPGTPLASRAGGEKYCCPLFSSKALTQENSPYSSFRLVNPPGLSLHPEGEGGKWINER
                     GREQCPSAWPLLLFLHFAEAGRRQPPDWADPQADLQQV"
BASE COUNT          499 a          573 c          617 g          438 t
ORIGIN      
        1 cggggaggag gaaaggaata ggatagagag tggaatgggg tcggtagggg tctcaaggac
       61 tggctatcct gacagccttc cccgcgttca ggttgaccaa catggcctgc agccagaggg
      121 cacccacctg acccttaaag agaggacaag ttgggtggag tctgtggctg acactctgtg
      181 cacaatcctt acaacactgg tgatggtgag aagggaaaga cgacaagcca gggggcatga
      241 tcccagcatg tgtgggagga gcttctaaat tatccactag cacaagcccg tcagtggccc
      301 catgcataaa tgtacacaga aacaggtggg gtcaagcagg gagagagaac tggccagggt
      361 ataaaaaggg cccacaagag accggctcta ggatcccaag gcccaactcc ccgaaccact
      421 cagggtcctg tggacagctc acctagtggc aatggctcca ggtaagcgcc cctaaaatcc
      481 ctttgggcac aacgtgtcct gaggggagag gcagcgccct gtagatggga cgggggcact
      541 aaccctcagg tttggggctt atgaatgtga gtatcgccat ctaaggccag atatttggcc
      601 aatctctgaa tgttcctggt ctctggaggg atggagagag agaaaaaaaa caaacagctc
      661 ctggagcagg gagagcgctg gcctcttcct ctccggctcc ctccattgcc ctccggtttc
      721 tccccaggct cccggacgtc cctgctcctg gcttttgccc tgctctgcct gccctggctt
      781 caagaggctg gtgccgtcca aaccgttccg ttatccaggc tttttgacca cgctatgctc
      841 caagcccatc gcgcgcacca gctggccatt gacacctacc aggagtttgt aagttcttgg
      901 ggaatgggtg cgggtcaggg gtggcaagaa ggggtgactt tcccccactg gggaagtaat
      961 gggaggagac taaggagctc agggttgttt tctgaagcga aaatgcaggc agatgagcat
     1021 aggctgagcc aggttcccag aaaagcaaca atgggagctg gtctccagca tagaaaccag
     1081 cagtccttct tggtgggggg tccttctcct aggaagaaac ctatatccca aaggaccaga
     1141 agtattcatt cctgcatgac tcccagacct ccttctgctt ctcagactct attccgacac
     1201 cctccaacat ggaggaaacg caacagaaat ccgtgagtgg atgccgtctc ccctaggcgg
     1261 ggatggggga gacctgtggt cagggctccc gggcagcaca gccactgccg gtccttcccc
     1321 tgcagaatct agagctgctc cgcatctccc tgctgctcat cgagtcgtgg ctggagcccg
     1381 tgcggttcct caggagtatg ttcgccaaca acctggtgta tgacacctcg gacagcgatg
     1441 actatcacct cctaaaggac ctagaggaag gcatccaaac gctgatgggg gtgagggtgg
     1501 cgccaggggt caccaatcct ggaaccccac tggcttcgag ggctggggga gagaaatact
     1561 gctgccctct ttttagcagt aaggcgctga cccaagagaa ctcaccttat tcttcatttc
     1621 gcctggtgaa tcctccaggc ctttctctac accctgaagg ggagggagga aaatggataa
     1681 atgagagagg gagggaacag tgcccaagcg cttggcctct ccttctcttc cttcactttg
     1741 cagaggctgg aagacggcag ccgccggact gggcagatcc tcaagcagac ctacagcaag
     1801 tttgacacaa actcgcacaa ccatgacgca ctgctcaaga actacgggct gctctactgc
     1861 ttcaggaagg acatggacaa ggtcgagaca ttcctgcgca tggtgcagtg ccgctctgtg
     1921 gagggcagct gtggcttcta ggtgcccgag tagcatcctg tgacccctcc ccagtgcctc
     1981 tcctggccct gaaggtgcca ctccagtgcc caccagcctt gtcctaataa aattaagttg
     2041 tatcatttca tctgactagg tgtcattcta taatattatg gggtggaagg tggtggtatg
     2101 gagcaagggg taggtggaaa gaagacc
//