LOCUS       ECOPYU01                 154 bp    DNA     linear   BCT 27-JUN-2008
DEFINITION  Escherichia coli gene for hypothetical protein, partial cds,
            clone: PYU1.
ACCESSION   D21139
VERSION     D21139.1
KEYWORDS    .
SOURCE      Escherichia coli
  ORGANISM  Escherichia coli
            Bacteria; Pseudomonadati; Pseudomonadota; Gammaproteobacteria;
            Enterobacterales; Enterobacteriaceae; Escherichia.
REFERENCE   1  (bases 1 to 154)
  AUTHORS   Yamada,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-OCT-1993)
            Contact:Mamoru Yamada
            Yamaguchi University, Faculty of Agriculture, Dept. of Biological
            Chemistry; 1677-1 Yoshida, Yamaguchi, Yamaguchi 753, Japan
REFERENCE   2  
  AUTHORS   Yamada,M., Yanai,S. and Talkuder,A.
  TITLE     Analysis of products of the Escherichia coli genomic genes and
            regulation of their expressions: an applicable procedure for
            genomic analysis of other microorganisms
  JOURNAL   Biosci. Biotechnol. Biochem. 58, 117-120 (1994)
COMMENT     
FEATURES             Location/Qualifiers
     source          1..154
                     /clone="PYU1"
                     /db_xref="taxon:562"
                     /mol_type="genomic DNA"
                     /note="clone_lib: library of S. Yanai and M. Yamada"
                     /note="sub_strain: W3110"
                     /organism="Escherichia coli"
                     /strain="K-12"
     CDS             34..>154
                     /codon_start=1
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="the coding frame was determined by the Lac fusion"
                     /product="hypothetical protein"
                     /protein_id="BAA04675.1"
                     /transl_table=11
                     /translation="MQENQQITKKAQYNLNKLQKRLRRNVGEAIADFNMIEEGD"
BASE COUNT           63 a           31 c           28 g           32 t
ORIGIN      
        1 atttgcccca tttagtacca gagaactgaa ataatgcaag aaaatcaaca aattacaaag
       61 aaagcacaat acaacctgaa caaattacaa aaacgtctgc gtcgtaacgt gggcgaagcc
      121 attgctgact tcaatatgat tgaagaaggc gatc
//