LOCUS PETHF1 1846 bp mRNA linear PLN 03-AUG-2001 DEFINITION Petunia hybrida F3'5'H mRNA for flavonoid-3',5'-hydroxylase, complete cds. ACCESSION D14588 VERSION D14588.1 KEYWORDS . SOURCE Petunia hybrida ORGANISM Petunia x hybrida Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia. REFERENCE 1 (bases 1 to 1846) AUTHORS Shimada,Y. TITLE Direct Submission JOURNAL Submitted (08-MAR-1993) to the DDBJ/EMBL/GenBank databases. Contact:Yukihisa Shimada RIKEN, Plant Science Center, Laboratory for Growth Regulation; 2-1 Hirosawa, Wako, Saitama 351-0198, Japan REFERENCE 2 AUTHORS Kikuchi,Y., Kiyokawa,S., Shimada,Y., Shimada,R., Ohbayashi,M. and Okinaka,Y. TITLE A gene coding for flavonoid-3', 5'-hydrogenase has been cloned by a DNA probe prepared from a cDNA library derived from petunia petals by the SSP. PCR method using a gene sequence coding for the amino acid sequence of a hemebinding region of cytochrome P450 as a primer. Futher, a transformed plant having bluer petals than usual has been obtained by introducing the cloned gene into a plant and expressing the same. The invention can provide a plant having a pigment pattern which the flower or fruit does not possess naturally JOURNAL Patent: WO 9318155-A 16-SEP-1993 REFERENCE 3 AUTHORS Kikuchi,Y., Kiyokawa,S., Shimada,Y., Shimada,R., Ohbayashi,M. and Okinaka,Y. TITLE A gene coding for flavonoid-3', 5'-hydrogenase has been cloned by a DNA probe prepared from a cDNA library derived from petunia petals by the SSP. PCR method using a gene sequence coding for the amino acid sequence of a hemebinding region of cytochrome P450 as a primer. Futher, a transformed plant having bluer petals than usual has been obtained by introducing the cloned gene into a plant and expressing the same. The invention can provide a plant having a pigment pattern which the flower or fruit does not possess naturally JOURNAL Patent: JP 9244963-A 02-MAR-1992 REFERENCE 4 AUTHORS Shimada,Y., Ohbayashi,M., Nakano-Shimada,R., Okinaka,Y., Kiyokawa,S. and Kikuchi,Y. TITLE A novel method to clone P450s with modified single-specific-primer PCR JOURNAL Plant Mol. Biol. Rep. 17, 355-361 (1999) REFERENCE 5 AUTHORS Shimada,Y., Ohbayashi,M., Nakano-Shimada,R., Okinaka,Y., Kiyokawa,S. and Kikuchi,Y. TITLE Genetic engineering of the anthocyanin biosynthetic pathway with flavonoid-3',5'-hydroxylase: specific switching of the pathway in petunia JOURNAL Plant Cell Rep. 20, 456-462 (2001) COMMENT FEATURES Location/Qualifiers source 1..1846 /db_xref="taxon:4102" /dev_stage="flower bud" /mol_type="mRNA" /organism="Petunia hybrida" /strain="Falcon Blue" /tissue_type="petal" CDS 49..1569 /codon_start=1 /gene="F3'5'H" /note="Hf1" /product="flavonoid-3',5'-hydroxylase" /protein_id="BAA03438.1" /translation="MMLLTELGAATSIFLIAHIIISTLISKTTGRHLPPGPRGWPVIG ALPLLGAMPHVSLAKMAKKYGAIMYLKVGTCGMAVASTPDAAKAFLKTLDINFSNRPP NAGATHLAYNAQDMVFAHYGPRWKLLRKLSNLHMLGGKALENWANVRANELGHMLKSM SDMSREGQRVVVAEMLTFAMANMIGQVMLSKRVFVDKGVEVNEFKDMVVELMTIAGYF NIGDFIPCLAWMDLQGIEKRMKRLHKKFDALLTKMFDEHKATTYERKGKPDFLDVVME NGDNSEGERLSTTNIKALLLNLFTAGTDTSSSAIEWALAEMMKNPAILKKAQAEMDQV IGRNRRLLESDIPNLPYLRAICKETFRKHPSTPLNLPRISNEPCIVDGYYIPKNTRLS VNIWAIGRDPQVWENPLEFNPERFLSGRNSKIDPRGNDFELIPFGAGRRICAGTRMGI VMVEYILGTLVHSFDWKLPSEVIELNMEEAFGLALQKAVPLEAMVTPRLQLDVYVP" BASE COUNT 569 a 316 c 401 g 560 t ORIGIN 1 tatcttgatc aaaatattta cttcggccat atacgttttc ctttagtcat gatgctactt 61 actgagcttg gtgcagcaac ttcaatcttt ctaatagcac acataatcat ttcaactctt 121 atttcaaaaa ctaccggccg gcatctaccg ccggggccaa gagggtggcc ggtgatcgga 181 gcacttccac ttttaggagc catgccacat gtttccttag ctaaaatggc aaaaaaatat 241 ggagcaatca tgtatctcaa agttggaaca tgtggcatgg cagttgcttc tacccctgat 301 gctgctaaag cattcttgaa aacacttgat atcaacttct ccaatcgtcc acctaatgca 361 ggtgccactc acttagctta taatgctcaa gacatggttt ttgcacatta tggaccacga 421 tggaagttgc taaggaaatt aagcaacttg catatgctag ggggaaaagc cttagagaat 481 tgggcaaatg ttcgtgccaa tgagctaggg cacatgctaa aatcaatgtc cgatatgagt 541 cgagagggcc agagggttgt ggtggcggag atgttgacat ttgccatggc caatatgatc 601 ggacaagtga tgctaagcaa aagagtattt gtagataaag gtgttgaggt aaatgaattt 661 aaggacatgg ttgtagagtt aatgacaata gcagggtatt tcaacattgg tgattttatt 721 ccttgtttag cttggatgga tttacaaggg atagaaaaac gaatgaaacg tttacataag 781 aagtttgatg ctttattgac aaagatgttt gatgaacaca aagcaactac ctatgaacgt 841 aaggggaaac cagattttct tgatgttgtt atggaaaatg gggacaattc tgaaggagaa 901 agactcagta caaccaacat caaagcactt ttgctgaatt tgttcacagc tggtacggac 961 acttcttcta gtgcaataga atgggcactt gcagaaatga tgaagaaccc tgccattttg 1021 aaaaaagcac aagcagaaat ggatcaagtc attggaagaa ataggcgttt actcgaatcc 1081 gatatcccaa atctccctta cctccgagca atttgcaaag aaacatttcg aaaacaccct 1141 tctacaccat taaatcttcc taggatctcg aacgaaccat gcatagtcga tggttattac 1201 ataccaaaaa acactaggct tagtgttaac atatgggcaa ttggaagaga tccccaagtt 1261 tgggaaaatc cactagagtt taatcccgaa agattcttga gtggaagaaa ctccaagatt 1321 gatcctcgag ggaacgattt tgaattgata ccatttggtg ctggacgaag aatttgtgca 1381 ggaacaagaa tgggaattgt aatggtggaa tatatattag gaactttggt tcattcattt 1441 gattggaaat taccaagtga agttattgag ttgaatatgg aagaagcttt tggcttagct 1501 ttgcagaaag ctgtccctct tgaagctatg gttactccaa ggttacaatt ggatgtttat 1561 gtaccatagc tatagatgtg tattgtgcta taattgcgca tgttgttggt tgtagcatga 1621 gatattaaaa ggagtacatg aagcgcattg catgagttta acttgtagct ccttaatatt 1681 ttaggtattt ttcaattaat aagttcttgt tggttgggta tttttacaga atttagtact 1741 attattttgt caatttagaa ttgttacgct gaatttgttg ttccgccctt ttattttcag 1801 tttgattgta tccaaaggat gtcgaatgaa atcatactct ttacct //