LOCUS       MUMMP                   1417 bp    RNA     linear   VRL 19-DEC-2020
DEFINITION  Mumps orthorubulavirus Miyahara P gene for phosphoprotein,
            complete cds.
ACCESSION   D00352
VERSION     D00352.1
KEYWORDS    .
SOURCE      Mumps orthorubulavirus
  ORGANISM  Mumps orthorubulavirus
            Viruses; Riboviria; Orthornavirae; Negarnaviricota;
            Haploviricotina; Monjiviricetes; Mononegavirales; Paramyxoviridae;
            Rubulavirinae; Orthorubulavirus; Orthorubulavirus parotitidis.
REFERENCE   1  
  AUTHORS   Takeuchi,K., Hishiyama,M., Yamada,A. and Sugiura,A.
  TITLE     Molecular cloning and sequence analysis of the mumps virus gene
            encoding the P protein: mumps virus P gene is monocistromic
  JOURNAL   J. Gen. Virol. 69, 2043-2049 (1988)
COMMENT     The nucleotide sequence of the P (phosphoprotein) gene of two
            strains of mumps virus has been determined from overlapping cDNA
            clones. The P gene contained a single open reading frame coding for
            a protein of 391 amino acids with a calculated M of 41587, in good
            agreement with the value (40K to 45K) estimated from
            electrophoretic mobility on SDS-polyacrylamide gels. The homology
            of the mumps virus P gene between Miyahara strain and Enders strain
            is 95% and 96% at the nucleotide and amino acid lebels,
            respectively. No open reading frame analogous to the C gene of
            other paramyxoviruses existed in the mumps virus P gene region.
            Comparison of the amino acid sequence of the mumps virus P protein
            with that of Newcastle disease virus showed a limited sequence
            homology.
FEATURES             Location/Qualifiers
     source          1..1417
                     /db_xref="taxon:2560602"
                     /mol_type="genomic RNA"
                     /organism="Mumps orthorubulavirus"
                     /strain="Miyahara"
     CDS             160..1335
                     /codon_start=1
                     /gene="P"
                     /product="phosphoprotein"
                     /protein_id="BAA00260.1"
                     /translation="MDQFIKQDETGDLIETGMNVANHFLSAPIQGTNSLSKATIIPGV
                     APVLIGNPEQKNIQYPTTSHQGSKSKGRGSGARPIIVSSSEGGTGGTQVPEPLFAQTG
                     QGGIVTTVYQDPTIQPTGSYRSVELAKIGKERMINRFVEKPRTSTPVTEFKRGGPGAA
                     AQGQTIQEEGIDGNGASAGSKERSGSLSGATPYAHLSLPQQDSTPANVGIAPQSAISA
                     NEIMDLLRGMDARLQHLEQKVDKVLAQGSMVTQIKNELSTVKTTLATIEGMMATVKIM
                     DPGNPTGVPVDELRRSFSDHVTIVSGPGDVSFSSGEEPTLYLDELARPVPKPRPAKQP
                     KPQPVKDLAGRKVMITKMITDCVANPQMKQVFEQRLAKASTEDALNDIKRDIIRSAI"
BASE COUNT          461 a          335 c          335 g          286 t
ORIGIN      
        1 ccaattgcaa taaccccagg acaatctagc cacagctaac tgcccaaatc cactacattc
       61 cattcatatt tagtctttaa gaaaaaacta ggcccggaaa gaattagttc tacgagcatc
      121 gacacaatta tcttgatcgt gtttctttcc gggcaagcca tggaccaatt tataaaacaa
      181 gatgagactg gtgatttaat tgagacagga atgaacgttg caaatcattt cctatccgcc
      241 cccattcagg gaaccaactc gttgagcaag gccacaatca tccctggcgt tgcaccagta
      301 ctcattggca atccagagca aaagaacatt cagtacccca ccacatcaca tcagggatcc
      361 aagtcaaagg gcagaggctc aggggccagg cccatcatag tctcatcctc cgaaggaggc
      421 actggaggga ctcaggttcc tgagcccctt ttcgcacaaa caggacaagg tggcattgtc
      481 accaccgttt atcaggatcc aactatccaa ccaacaggtt catatcgaag tgtggaattg
      541 gctaagatag gaaaagagag aatgattaat cgatttgttg aaaaaccaag aacctcaacg
      601 ccggtaacag aatttaagag gggggggccg ggagcggctg ctcaaggcca gacaatccaa
      661 gaggagggca tagacgggaa tggagcctca gctgggtcca aggagaggtc cgggtctttg
      721 agtggtgcaa ccccatatgc tcacctatca ctgccgcagc aagattccac tcctgcaaat
      781 gtgggaattg ccccgcaaag tgcgatcagt gcgaacgaga ttatggacct ccttagaggg
      841 atggatgctc gcctgcaaca tcttgaacaa aaggtggaca aggtgcttgc acagggcagc
      901 atggtgaccc aaataaagaa tgaattatca acagtaaaga caacactagc tacaattgaa
      961 ggaatgatgg cgacagtaaa gatcatggat cctggaaacc cgacaggggt cccagttgat
     1021 gagcttagaa gaagttttag tgatcatgta acaattgtta gtggaccagg agatgtgtca
     1081 ttcagctccg gtgaagaacc cacactgtat ttggatgaac tagcgaggcc tgtcccaaag
     1141 ccccgtcctg caaagcagcc aaaaccccaa ccagtaaagg atttagcagg acggaaagtg
     1201 atgataacta aaatgatcac tgactgtgtg gccaatcctc aaatgaagca ggtgtttgag
     1261 caacgattgg caaaggccag caccgaggat gctctgaatg atatcaagcg agacatcata
     1321 agaagcgcca tatgaactca ccaggaacac cagactcacg ggaaaatcca caaactgaaa
     1381 gccacaatga ttccctgttt aataaaaaaa aaaaaaa
//