LOCUS       CT010167                 837 bp    mRNA    linear   ROD 21-OCT-2008
DEFINITION  Mus musculus full open reading frame cDNA clone RZPDo836A0950D for
            gene Lyl1, Lymphoblastomic leukemia; complete cds, incl. stopcodon.
ACCESSION   CT010167
VERSION     CT010167.1
KEYWORDS    Full ORF clone, Expression Shuttle System, Gateway(R), complete
            cds.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 837)
  AUTHORS   Ebert L., Muenstermann E., Schatten R., Henze S., Bohn E.,
            Mollenhauer J., Wiemann S., Schick M., Korn B.
  TITLE     Cloning of mouse full open reading frames in Gateway(R) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 837)
  AUTHORS   Ebert L., Muenstermann E., Schatten R., Henze S., Bohn E.,
            Mollenhauer J., Wiemann S., Schick M., Korn B.
  JOURNAL   Submitted (20-JUL-2005) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            515, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo836A0950D, ORFNo 30078
            http://www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo836A0950D
            Mouse Full ORF Gateway(R) Clones - RZPD (kan-resist.)
            RZPDLIB No. 836
            http://www.rzpd.de/cgi-bin/products/showLib.pl.cgi/
            response?libNo=836
            http://www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            http://www.rzpd.de
            This clone is available from RZPD;
            Contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is part of a collection of mouse full ORF clones
            jointly established and verified by DKFZ (www.dkfz.de) and RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The stopcodon is followed by the 3' att site:
            GACCCAGCTTTCTTGTAC..att
            The clone is validated by full sequence check.
            Compared to the reference sequence AK076114 (GI:26345089)
            we found AA exchange(s) at position (first base of changed
            triplet):
            19(arg->gly)
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..837
                     /organism="Mus musculus"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Mouse Full ORF Gateway(R) Clones - RZPD"
                     /clone="RZPDo836A0950D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:10090"
     CDS             1..837
                     /codon_start=1
                     /gene="Lyl1"
                     /db_xref="GOA:P27792"
                     /db_xref="InterPro:IPR011598"
                     /db_xref="InterPro:IPR036638"
                     /db_xref="InterPro:IPR040238"
                     /db_xref="MGI:MGI:96891"
                     /db_xref="UniProtKB/Swiss-Prot:P27792"
                     /protein_id="CAJ18375.1"
                     /translation="MCPPQAGAEVGSAMTEKTEMVCASSPAPAPPSKPASPGPLSTEE
                     VDHRNTCTPWLPPGVPVINLGHTRPIGAAMPTTELSAFRPSLLQLTALGRAPPTLAVH
                     YHPHPFLNSVYIGPAGPFSIFPNSRLKRRPSHSELDLADGHQPQKVARRVFTNSRERW
                     RQQHVNGAFAELRKLLPTHPPDRKLSKNEVLRLAMKYIGFLVRLLRDQTAVLTSGPSA
                     PGSRKPPARRGVEGSARFGAGHRVEAARSQPVLPGDCDGDPNGSVRPIKLEQTSLSPE
                     VR"
BASE COUNT          166 a          285 c          248 g          138 t
ORIGIN      
        1 atgtgcccgc cccaggccgg agcagaggtg ggttccgcca tgactgagaa aactgagatg
       61 gtatgtgcct ccagcccagc acctgcccct ccctctaagc cggcctcacc tgggcccctt
      121 tctacagagg aggtggacca ccgaaacacg tgcactccct ggttgcctcc cggcgtgcca
      181 gtgataaacc tgggacacac caggcccata ggggcagcca tgcccaccac agagctcagt
      241 gcctttcggc cctccttgct gcagctaact gccttgggaa gagctccacc taccctggct
      301 gtacattacc accctcaccc cttcctcaac agtgtctaca ttgggccagc aggacccttc
      361 agcatcttcc ctaacagccg gctgaagcgc agaccaagcc atagtgagct ggacttggct
      421 gacgggcacc aaccccagaa ggtggctcgg cgagtgttca ccaacagccg tgagcgctgg
      481 cggcagcagc acgttaacgg cgccttcgca gagctcagga agctgctgcc gacccacccg
      541 cccgaccgga agctgagcaa gaacgaggtg ctgcgcctgg ccatgaagta tataggcttc
      601 ctggtgcggc tgctgcgaga ccaaacggct gtgctgacct ccggccccag cgctcccggg
      661 tcccgcaagc cacctgcgcg caggggcgtg gagggcagcg cacgcttcgg ggccgggcac
      721 agagtagagg ctgcacgctc acagcccgtg cttcctgggg actgtgatgg cgaccccaat
      781 gggtcagtga gacccatcaa gttggagcag acatccctga gtcctgaggt gcggtag
//