LOCUS       CR541788                 384 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834F0930D for
            gene SNCG, synuclein, gamma (breast cancer-specific protein 1);
            complete cds, incl. stopcodon.
ACCESSION   CR541788
VERSION     CR541788.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 384)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 384)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  JOURNAL   Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834F0930D, ORFNo 3605
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834F0930D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            Contact RZPD (customer.service@rzpd.de) for further information.
            Clone name at Harvard Institute of Proteomics
            (www.hip.harvard.edu):
            FLH131021.01X
            
            This CDS clone is part of a collection of human full ORF clones
            jointly established and verified by the Harvard Institute of
            Proteomics (HIP) and RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The stopcodon is followed by the 3' att site: GACCCAGCTTTCTT..att
            The clone is validated by full sequence check.
            Compared to the reference sequence BC014098
            we did not find any amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..384
                     /db_xref="H-InvDB:HIT000268659"
                     /organism="Homo sapiens"
                     /lab_host="DH5Alpha"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834F0930D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..384
                     /codon_start=1
                     /gene="SNCG"
                     /db_xref="GOA:Q6FHG5"
                     /db_xref="H-InvDB:HIT000268659.12"
                     /db_xref="InterPro:IPR001058"
                     /db_xref="InterPro:IPR002462"
                     /db_xref="UniProtKB/TrEMBL:Q6FHG5"
                     /protein_id="CAG46587.1"
                     /translation="MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKT
                     KENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRP
                     SAPQQEGEASKEKEEVAEEAQSGGD"
BASE COUNT          103 a           82 c          150 g           49 t
ORIGIN      
        1 atggatgtct tcaagaaggg cttctccatc gccaaggagg gcgtggtggg tgcggtggaa
       61 aagaccaagc agggggtgac ggaagcagct gagaagacca aggagggggt catgtatgtg
      121 ggagccaaga ccaaggagaa tgttgtacag agcgtgacct cagtggccga gaagaccaag
      181 gagcaggcca acgccgtgag cgaggctgtg gtgagcagcg tcaacactgt ggccaccaag
      241 accgtggagg aggcggagaa catcgcggtc acctccgggg tggtgcgcaa ggaggacttg
      301 aggccatctg ccccccaaca ggagggtgag gcatccaaag agaaagagga agtggcagag
      361 gaggcccaga gtgggggaga ctag
//