LOCUS CR450318 468 bp mRNA linear HUM 17-APR-2005 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834G111D for gene RNASE1, ribonuclease, RNase A family, 1 (pancreatic); complete cds; without stopcodon. ACCESSION CR450318 VERSION CR450318.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 468) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 468) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (18-MAY-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834G111D, ORFNo 168 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834G111D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Ina Rolfs RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 101 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned without stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon (ATG): att..AAAAAA GCT GGC ACC CCT GGT CCA GGT (ATG) After the last codon additional sequence has been added: CCA GGC CCA GGC GGC G in front of the 3' att site (AC CCA GCT TTC TT). Compared to the reference sequence NM_002933 we found amino acid exchange(s) at position (first base of changed triplet): 199(arg->leu) Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..468 /db_xref="H-InvDB:HIT000267227" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834G111D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..>468 /codon_start=1 /gene="RNASE1" /db_xref="GOA:P07998" /db_xref="H-InvDB:HIT000267227.11" /db_xref="HGNC:HGNC:10044" /db_xref="InterPro:IPR001427" /db_xref="InterPro:IPR023411" /db_xref="InterPro:IPR023412" /db_xref="InterPro:IPR036816" /db_xref="PDB:1DZA" /db_xref="PDB:1E21" /db_xref="PDB:1H8X" /db_xref="PDB:1Z7X" /db_xref="PDB:2E0J" /db_xref="PDB:2E0L" /db_xref="PDB:2E0M" /db_xref="PDB:2E0O" /db_xref="PDB:2K11" /db_xref="PDB:2Q4G" /db_xref="PDB:3F8G" /db_xref="PDB:4KXH" /db_xref="UniProtKB/Swiss-Prot:P07998" /protein_id="CAG29314.1" /translation="MALEKSLVRLLLLVLILLVLGWVQPSLGKESRAKKFQRQHMDSD SSPSSSSTYCNQMMRRRNMTQGLCKPVNTFVHEPLVDVQNVCFQEKVTCKNGQGNCYK SNSSMHITDCRLTNGSRYPNCAYRTSPKERHIIVACEGSPYVPVHFDASVEDST" BASE COUNT 113 a 137 c 125 g 93 t ORIGIN 1 atggctctgg agaagtctct tgtccggctc cttctgcttg tcctgatact gctggtgctg 61 ggctgggtcc agccttccct gggcaaggaa tcccgggcca agaaattcca gcggcagcat 121 atggactcag acagttcccc cagcagcagc tccacctact gtaaccaaat gatgaggcgc 181 cggaatatga cacaggggct gtgcaaacca gtgaacacct ttgtgcacga gcccctggta 241 gatgtccaga atgtctgttt ccaggaaaag gtcacctgca agaacgggca gggcaactgc 301 tacaagagca actccagcat gcacatcaca gactgccgcc tgacaaacgg ctccaggtac 361 cccaactgtg cataccggac cagcccgaag gagagacaca tcattgtggc ctgtgaaggg 421 agcccatatg tgccagtcca ctttgatgct tctgtggagg actctacc //