LOCUS BT044421 1760 bp mRNA linear INV 13-SEP-2008 DEFINITION Drosophila melanogaster FI09231 full insert cDNA. ACCESSION BT044421 VERSION BT044421.1 KEYWORDS FLI_CDNA. SOURCE Drosophila melanogaster (fruit fly) ORGANISM Drosophila melanogaster Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. REFERENCE 1 (bases 1 to 1760) AUTHORS Carlson,J., Booth,B., Frise,E., Park,S., Wan,K., Yu,C. and Celniker,S. TITLE Direct Submission JOURNAL Submitted (13-SEP-2008) Berkeley Drosophila Genome Project, Lawrence Berkeley National Laboratory, One Cyclotron Road, Berkeley, CA 94720, USA COMMENT Sequence submitted by: Berkeley Drosophila Genome Project Lawrence Berkeley National Laboratory Berkeley, CA 94720 This clone was sequenced as part of a high-throughput process to sequence clones from the Drosophila Gene Collection The sequence has been subjected to integrity checks for sequence accuracy, presence of a polyA tail and contiguity within 100 kb in the genome. Thus we believe the sequence to reflect accurately this particular cDNA clone. However, there are artifacts associated with the generation of cDNA clones that may have not been detected in our initial analyses such as internal priming, priming from contaminating genomic DNA, retained introns due to reverse transcription of unspliced precursor RNAs, and reverse transcriptase errors that result in single base changes. For further information about this sequence, including its location and relationship to other sequences, please visit our Web site (http://www.fruitfly.org) or send email to cdna@fruitfly.org. FEATURES Location/Qualifiers source 1..1760 /organism="Drosophila melanogaster" /mol_type="mRNA" /db_xref="taxon:7227" gene 1..1760 /gene="amd-RB" /map="2L" /db_xref="FLYBASE:FBtr0081153" CDS 113..1645 /gene="amd-RB" /note="Longest ORF" /codon_start=1 /product="FI09231p" /protein_id="ACH92486.1" /db_xref="FLYBASE:FBtr0081153" /translation="MDFDEFREFGHASIEFLINYLSGIRERDVLPSTAPYAVINQLPK EIPEQPDHWREVLKDLENIILPGLTHWQSPYFNAFYPSSSSAGSIIGELLIAGIGVLG FSWICSPACTELEVVVMDWLAKFLKLPAHFQHASDGPGGGVIQGSASEAVLVAVLAAR EQAVANYRESHPELSESEVRGRLVAYSSDQSNSCIEKAGVLAAMPIRLLPAGEDFVLR GDTLRGAIEEDVAAGRIPVICVATLGTTGTCAYDDIESLSAVCEEFKVWLHVDAAYAG GAFALEECSDLRKGLDRVDSLNFNLHKFMLVNFDCSAMWLRDANKVVDSFNVDRIYLK HKHEGQSQIPDFRHWQIPLGRRFRALKVWITFRTLGAEGLRNHVRKHIELAKQFEQLV LKDSRFELVAPRALGLVCFRPKGDNEITTQLLQRLMDRKKIYMVKAEHAGRQFLRFVV CGMDTKASDIDFAWQEIESQLTDLQAEQSLVARKSGNVGDLAQHFQIHLSTENATHEK SQ" BASE COUNT 410 a 445 c 500 g 405 t ORIGIN 1 atttgtagat tcgaatgtca gcggtgaaca agtgcggaac cagcggagcg gctaaatacc 61 caaattcccc cccaaagtaa atcgcgcctt tttttttgga ttaaccagga tcatggactt 121 tgatgagttc cgtgaatttg gccatgcctc catcgagttc cttatcaact atctgagcgg 181 catacgtgag agggatgtcc tgcccagcac ggctccatat gcggtgatca atcagctgcc 241 caaggagatt cccgagcagc ccgatcattg gcgcgaggtc ctcaaggatc tggagaacat 301 catcctgccg ggtctgaccc actggcaatc gccctacttc aatgccttct atccgtcatc 361 ctcgtcggcg ggctccatca tcggtgagct gctgatcgcg ggcatcggag tccttggatt 421 cagttggatc tgcagtcccg cctgcacaga actggaggtg gtggtcatgg actggctggc 481 caagttcctg aagctgcccg cacacttcca gcacgccagc gatggaccag gaggcggggt 541 gatccaggga tcagctagcg aggctgtgtt ggtggctgtc ctagctgcca gggaacaagc 601 tgtggccaac tacagggaat cgcatccgga gctgagcgaa agtgaggtgc gtggccgctt 661 ggtggcctac tcctcggacc agagtaacag ctgcattgag aaggctggag tcctggctgc 721 catgccgatt cgattgctgc cggctggaga ggatttcgta cttagaggcg atacactgag 781 aggagccatc gaggaggacg tggcagcggg caggattccg gtgatctgcg ttgccactct 841 gggcaccacg ggcacttgtg cctatgacga cattgaatcc ctgtccgctg tctgcgagga 901 attcaaggtg tggctccatg ttgatgccgc gtatgccggt ggagcctttg ctctggagga 961 atgttcggat ttgcgaaagg gattggatcg cgtggactcg ctaaacttca acctgcacaa 1021 gttcatgctg gtcaacttcg attgctcggc catgtggcta agggatgcca acaaggtggt 1081 cgacagcttc aatgtggatc gcatctacct gaagcacaag cacgagggtc agtcgcaaat 1141 tcctgacttc cgtcattggc aaatccccct gggtcgccgc ttccgagctc taaaagtctg 1201 gatcacattc cgcactctgg gagccgaggg attgcgaaac catgtgcgca agcacatcga 1261 gttggccaaa cagtttgagc agcttgtgct caaggattcg cgattcgagc tggtggctcc 1321 tcgtgccctg ggactggttt gtttccggcc caaaggtgac aatgagatta ccacccagtt 1381 gctgcaacgg cttatggatc gaaagaagat ctacatggtt aaggccgagc atgcgggtcg 1441 tcagtttctg cgattcgtcg tatgcggcat ggacaccaaa gcctccgata ttgatttcgc 1501 ctggcaggag atcgagtctc aactgacgga cctgcaggcg gagcaatcct tggtggcccg 1561 caaatcggga aacgtcggcg atcttgcgca gcacttccag atccatctga gcaccgaaaa 1621 tgcaacgcac gagaaatctc agtgagaaaa acggataaac tatttatgtt tagggacaac 1681 ctagttagtt tgcgatgtag tttttaactt tccacatgtt tataaataaa gtgaaattaa 1741 atgtaaaaaa aaaaaaaaaa //