LOCUS       BT020104                 690 bp    mRNA    linear   HUM 28-OCT-2004
DEFINITION  Homo sapiens ubiquitin B mRNA, complete cds.
ACCESSION   BT020104
VERSION     BT020104.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 690)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Cloning of human full-length CDSs in BD Creator(TM) System Donor
            vector
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 690)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-OCT-2004) BD Biosciences Clontech, 1020 East Meadow
            circle, Palo Alto, California 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..690
                     /db_xref="H-InvDB:HIT000266816"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH01579X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..690
                     /codon_start=1
                     /product="ubiquitin B"
                     /protein_id="AAV38907.1"
                     /translation="MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI
                     FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENV
                     KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTL
                     TGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKEST
                     LHLVLRLRGGC"
BASE COUNT          186 a          196 c          184 g          124 t
ORIGIN      
        1 atgcagatct tcgtgaaaac ccttaccggc aagaccatca cccttgaggt ggagcccagt
       61 gacaccatcg aaaatgtgaa ggccaagatc caggataagg aaggcattcc ccccgaccag
      121 cagaggctca tctttgcagg caagcagctg gaagatggcc gtactctttc tgactacaac
      181 atccagaagg agtcgaccct gcacctggtc ctgcgtctga gaggtggtat gcagatcttc
      241 gtgaagaccc tgaccggcaa gaccatcacc ctggaagtgg agcccagtga caccatcgaa
      301 aatgtgaagg ccaagatcca ggataaagaa ggcatccctc ccgaccagca gaggctcatc
      361 tttgcaggca agcagctgga agatggccgc actctttctg actacaacat ccagaaggag
      421 tcgaccctgc acctggtcct gcgtctgaga ggtggtatgc agatcttcgt gaagaccctg
      481 accggcaaga ccatcactct ggaggtggag cccagtgaca ccatcgaaaa tgtgaaggcc
      541 aagatccaag ataaagaagg catccccccc gaccagcaga ggctcatctt tgcaggcaag
      601 cagctggaag atggccgcac tctttctgac tacaacatcc agaaagagtc gaccctgcac
      661 ctggtcctgc gcctgagggg tggctgttag
//