LOCUS       BT011287                 273 bp    mRNA    linear   PLN 14-JAN-2004
DEFINITION  Arabidopsis thaliana At5g18010 gene, complete cds.
ACCESSION   BT011287
VERSION     BT011287.1
KEYWORDS    FLI_CDNA.
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 273)
  AUTHORS   Cheuk,R., Chen,H., Kim,C.J., Shinn,P. and Ecker,J.R.
  TITLE     Arabidopsis ORF clones
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 273)
  AUTHORS   Cheuk,R., Chen,H., Kim,C.J., Shinn,P. and Ecker,J.R.
  TITLE     Direct Submission
  JOURNAL   Submitted (14-JAN-2004) Salk Institute Genomic Analysis Laboratory
            (SIGnAL), Plant Biology Laboratory, The Salk Institute for
            Biological Studies, 10010 N. Torrey Pines Road, La Jolla, CA 92037,
            USA
FEATURES             Location/Qualifiers
     source          1..273
                     /organism="Arabidopsis thaliana"
                     /mol_type="mRNA"
                     /db_xref="taxon:3702"
                     /chromosome="5"
                     /clone="C62991"
                     /ecotype="Columbia"
                     /note="This clone is in pUNI 51"
     CDS             1..273
                     /note="unknown protein"
                     /codon_start=1
                     /product="At5g18010"
                     /protein_id="AAR92323.1"
                     /translation="MAFVRSLLGAKKILSRSTAAGSAAPKGFLAVYVGESQKKRYLVP
                     LSYLSQPSFQALLSKSEEEFGFAHPMGGLTIPCPEDTFINVTSRLQ"
BASE COUNT           69 a           63 c           71 g           70 t
ORIGIN      
        1 atggctttcg tgagaagtct attgggagca aagaagattc taagccgctc caccgcagca
       61 ggatctgcgg caccaaaagg gtttcttgcg gtgtacgtag gagagagcca gaagaagaga
      121 tatttggtgc cgctctcata cttgagccaa ccgtcatttc aagctctgct cagtaaatcc
      181 gaagaagagt ttgggtttgc tcatccgatg ggtggcttaa cgatcccttg tcccgaagat
      241 actttcatca atgtgacttc tcggctccaa tga
//