LOCUS BC129549 870 bp mRNA linear VRT 26-JUN-2007 DEFINITION Xenopus laevis hypothetical protein LOC100037175, mRNA (cDNA clone MGC:160214 IMAGE:8462357), complete cds. ACCESSION BC129549 VERSION BC129549.1 KEYWORDS MGC. SOURCE Xenopus laevis (African clawed frog) ORGANISM Xenopus laevis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Xenopus. REFERENCE 1 (bases 1 to 870) AUTHORS Klein,S.L., Strausberg,R.L., Wagner,L., Pontius,J., Clifton,S.W. and Richardson,P. TITLE Genetic and genomic tools for Xenopus research: The NIH Xenopus initiative JOURNAL Dev. Dyn. 225 (4), 384-391 (2002) PUBMED 12454917 REFERENCE 2 (bases 1 to 870) AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G., Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D., Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K., Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F., Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L., Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L., Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S., Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J., Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J., McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S., Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W., Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A., Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S., Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y., Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D., Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M., Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E., Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A. CONSRTM Mammalian Gene Collection Program Team TITLE Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002) PUBMED 12477932 REFERENCE 3 (bases 1 to 870) AUTHORS Klein,S. and Gerhard,D.S. TITLE Direct Submission JOURNAL Submitted (22-DEC-2006) National Institutes of Health, Xenopus Gene Collection (XGC), National Institute of Child Health and Human Development, 6100 Executive Boulevard, Room 4B01, Rockville, MD 20892-7510, USA REMARK NIH-MGC Project COMMENT Contact: XGC help desk Email: cgapbs-r@mail.nih.gov Tissue Procurement: Jacques Robert cDNA Library Preparation: Express Genomics cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL) DNA Sequencing by: Sequencing Group at the Stanford Human Genome Center, Stanford University School of Medicine, Stanford, CA 94305 Web site: http://www-shgc.stanford.edu Contact: (Dickson, Mark) mcd@paxil.stanford.edu Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers, R. M. Clone distribution: MGC clone distribution information can be found through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov Series: IRAK Plate: 297 Row: b Column: 12 This clone was selected for full length sequencing because it passed the following selection criteria: matched mRNA gi: 125858114. FEATURES Location/Qualifiers source 1..870 /organism="Xenopus laevis" /mol_type="mRNA" /db_xref="taxon:8355" /clone="MGC:160214 IMAGE:8462357" /tissue_type="Spleen, 2-3 years old, 4 females + 2 males, 6 outbreads" /clone_lib="NICHD_XGC_sple_PHA" /lab_host="DH10B" /note="Vector: pCS111" gene 1..870 /gene="LOC100037175" /db_xref="GeneID:100037175" CDS 14..523 /gene="LOC100037175" /codon_start=1 /product="LOC100037175 protein" /protein_id="AAI29550.1" /db_xref="GeneID:100037175" /translation="MICLVLTIFAHIFPSAWTGINERTFLAIKPDGYQRRLVGEIIRR FEKKGFCLVALKIMQASEKLLRQHYIALQDKPFYDRLVKYMGSGPVVAMVWQGLDVVK TARVMIGETNPAHSLPGTIRGDFCIDVGRNVIHGSDSRESAQREIALWFQPDELVCWQ DSAERWIYE" BASE COUNT 238 a 190 c 211 g 231 t ORIGIN 1 ctccgctctc gccatgatct gtctggtgct caccatcttc gcgcacatct tcccgtcagc 61 ctggactgga atcaatgagc gcactttcct ggcaatcaaa cctgatggct accaacggcg 121 actggtgggc gagatcatcc gccgctttga gaaaaaggga ttctgtcttg tggccttgaa 181 gataatgcag gcctcggaga aactgctcag gcagcattac attgctctgc aggacaagcc 241 cttctatgac cggctcgtaa agtacatggg ttctggccca gtggttgcca tggtgtggca 301 gggcttagat gtggtgaaga ctgcacgtgt catgattgga gagacaaatc cagctcactc 361 tttaccgggc acaatccgag gagatttctg cattgatgtt ggcaggaatg ttatacacgg 421 cagtgactcg agggagagcg cccagcgaga gatcgctctt tggtttcagc ccgatgagct 481 tgtttgctgg caggacagtg ctgagagatg gatatatgaa taattagccg gatatatgaa 541 taattagcca gcctacaatg ttctcatgca gtcacttggg gcattaaggc tgtgcctggc 601 tagcactaca tgctgcactt gggagcatta agggacttct acaggagatt gacatccagg 661 aattcgtcca gcagagtagt attaatggag aatgcggttt tactctgcct ctcacgcact 721 acagcaaata ggcactttca cagattcttt tctaaaattg agttttttca ctttttttgc 781 ttgaatatag aatttttttt taaaataaaa gcaaaacaag ggcctcttgt ttctactaaa 841 ctaaaaaaaa aaaaaaaaaa aaaaaaaaaa //