LOCUS       AY954818                 648 bp    mRNA    linear   PLN 29-MAR-2005
DEFINITION  Arabidopsis thaliana hypothetical protein (At2g37210) mRNA,
            complete cds.
ACCESSION   AY954818
VERSION     AY954818.1
KEYWORDS    .
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 648)
  AUTHORS   Underwood,B.A., Xiao,Y., Moskal,W., Monaghan,E., Wang,W.,
            Redman,J., Wu,H.C., Utterback,T. and Town,C.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2005) Plant Genomics, The Institute for Genomic
            Research, 9712 Medical Center Drive, Rockville, MD 20850, USA
COMMENT     This clone is in the Gateway(TM) pENTR221 recombination vector and
            has been donated to the Arabidopsis Biological Resource Center. The
            cloned open reading frame is based on experimental evidence from 5'
            and 3' RACE products. ORFs that were experimentally verified to be
            contained in one exon were cloned by PCR from genomic DNA.  ORFs
            that spanned more than one exon were cloned by PCR from cDNA pools.
            Shine-Dalgarno and Kozak consensus sequences for protein expression
            are included between the attL1 site and the start codon. The open
            reading frame is in frame with the attL1 sequence and contains a
            stop codon.
FEATURES             Location/Qualifiers
     source          1..648
                     /organism="Arabidopsis thaliana"
                     /mol_type="mRNA"
                     /db_xref="taxon:3702"
                     /chromosome="2"
                     /clone="pENTR221-At2g37210"
                     /ecotype="Columbia"
     gene            1..648
                     /locus_tag="At2g37210"
     CDS             1..648
                     /locus_tag="At2g37210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="AAX55144.1"
                     /translation="MEIKGESMQKSKFRRICVFCGSSQGKKSSYQDAAVDLGNELVSR
                     NIDLVYGGGSIGLMGLVSQAVHDGGRHVIGIIPKTLMPRELTGETVGEVRAVADMHQR
                     KAEMAKHSDAFIALPGGYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDK
                     AVEEGFISPTAREIIVSAPTAKELVKKLEEYAPCHERVATKLCWEMERIGYSSEE"
BASE COUNT          186 a          117 c          175 g          170 t
ORIGIN      
        1 atggaaatca aaggtgaatc gatgcaaaag tcaaagttca gaagaatctg tgtcttctgt
       61 ggaagcagcc aaggcaagaa gagcagttac caagatgctg ctgttgacct cggcaacgaa
      121 ctggtttcaa ggaatattga tctagtctat ggaggtggga gcataggatt gatgggtttg
      181 gtttcacaag ctgttcatga tggtggtcgt catgttattg gaatcattcc caagaccctc
      241 atgcctagag agttgactgg tgaaacagta ggagaagtaa gagcagttgc agatatgcac
      301 caaaggaaag ctgagatggc taagcactct gatgctttta ttgccttacc aggtggttat
      361 ggaacacttg aagaattgct tgaagtcata acttgggctc agcttggtat acatgacaag
      421 ccggtgggtt tgctcaatgt tgatggatac tacaactctc tgctctcatt cattgacaaa
      481 gcagtcgaag aaggatttat tagcccgact gctcgtgaga tcatcgtctc cgcacctact
      541 gctaaagagc tggtgaaaaa gctagaggaa tatgcacctt gccatgaaag ggttgcaacg
      601 aagctttgtt gggagatgga acggattggt tactcctctg aagagtga
//