LOCUS       AY899211                 821 bp    mRNA    linear   ROD 15-JUN-2005
DEFINITION  Rattus norvegicus GTP-binding protein G-alpha-i2 splice variant b
            (Gnai2) mRNA, complete cds, alternatively spliced.
ACCESSION   AY899211
VERSION     AY899211.1
KEYWORDS    .
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 821)
  AUTHORS   Cioffi,J.A., Wackym,P.A., Erbe,C.B., Gaggl,W. and Popper,P.
  TITLE     Molecular characterization of two novel splice variants of G
            alphai2 in the rat vestibular periphery
  JOURNAL   Brain Res. Mol. Brain Res. 137 (1-2), 89-97 (2005)
   PUBMED   15950765
REFERENCE   2  (bases 1 to 821)
  AUTHORS   Wackym,P.A., Cioffi,J.A. and Erbe,C.B.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-JAN-2005) Otolaryngology and Communication Sciences,
            Medical College of Wisconsin, 9200 W. Wisconsin Ave, Milwaukee, WI
            53226, USA
FEATURES             Location/Qualifiers
     source          1..821
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /tissue_type="vestibular periphery"
     gene            1..821
                     /gene="Gnai2"
     CDS             4..522
                     /gene="Gnai2"
                     /note="G alpha inhibitory type 2 (b); alternatively
                     spliced"
                     /codon_start=1
                     /product="GTP-binding protein G-alpha-i2 splice variant b"
                     /protein_id="AAX07754.1"
                     /translation="MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGES
                     GKSTIVKQMKIIHEDGYSEEECRQYRAVVYSNTIQSIMAIVKAMGNLQIDFADPQRAD
                     DARQLFALSCAAEEQGMLPEDLSGVIRRLWADHGVQACFGRSREYQLNDSAAYYLNDL
                     ERIAQSDYIPFQ"
BASE COUNT          172 a          243 c          232 g          174 t
ORIGIN      
        1 aggatgggct gcaccgtgag cgccgaggac aaggcggcag ccgagcgctc taagatgatc
       61 gacaagaacc tgcgggagga cggcgagaag gcggcacggg aggtgaagtt gcttctgtta
      121 ggtgctggag aatcagggaa gagcaccatc gtcaagcaga tgaagatcat ccacgaggat
      181 ggctactcag aggaggagtg ccggcagtac cgtgcggttg tctacagcaa caccatccag
      241 tctatcatgg ccatcgtcaa agccatgggc aacctgcaga tcgactttgc tgacccccag
      301 cgtgcggatg atgccaggca gctgttcgca ctgtcctgtg ctgccgagga gcaaggcatg
      361 cttccggaag acctgtcggg cgtcatccgg aggctctggg ctgaccatgg tgtgcaagcc
      421 tgctttggcc gctcacggga atatcaactc aatgactcag ccgcttacta cctgaatgac
      481 ctggagcgca tagcacagag tgactatatc cctttccagt gattccgtgc cttgagtgtt
      541 tctgcctgtt tacacccatc cctctttggg cggccccctg ccctgccctc cacggaattg
      601 gattccaagg gctgttccag acaactgcca atgtcactga gggccctgcc ctgaagccct
      661 gggcccaggc tccattaacc taaatgtagc tccttagcgc taatctagga accgccgctg
      721 cctgctgagg gtcaggcccc tcacgccctc gccccaggcc cgggacctcc agcgttgaac
      781 acttccttgc ttttttcaca tgttttatgg aattgttcac a
//