LOCUS       AY508230                 877 bp    DNA     linear   BCT 16-MAR-2004
DEFINITION  Magnetospirillum magnetotacticum MamA (mamA) gene, complete cds.
ACCESSION   AY508230
VERSION     AY508230.1
KEYWORDS    .
SOURCE      Paramagnetospirillum magnetotacticum
  ORGANISM  Paramagnetospirillum magnetotacticum
            Bacteria; Pseudomonadota; Alphaproteobacteria; Rhodospirillales;
            Magnetospirillaceae; Paramagnetospirillum.
REFERENCE   1  (bases 1 to 877)
  AUTHORS   Komeili,A., Vali,H., Beveridge,T.J. and Newman,D.K.
  TITLE     Magnetosome vesicles are present before magnetite formation, and
            MamA is required for their activation
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (11), 3839-3844 (2004)
   PUBMED   15004275
REFERENCE   2  (bases 1 to 877)
  AUTHORS   Komeili,A.B. and Newman,D.K.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-DEC-2003) Geological and Planetary Sciences,
            California Institute of Technology, 1200 E. California Blvd. M/C
            100-23, Pasadena, CA 91125, USA
FEATURES             Location/Qualifiers
     source          1..877
                     /organism="Paramagnetospirillum magnetotacticum"
                     /mol_type="genomic DNA"
                     /strain="AMB-1"
                     /db_xref="taxon:188"
     gene            124..777
                     /gene="mamA"
     CDS             124..777
                     /gene="mamA"
                     /note="magnetosome associated TPR-containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="MamA"
                     /protein_id="AAR90856.1"
                     /translation="MSSKPSDILDEVTLYAHYGLSVAKKLGMNMVDAFRAAFSVNDDI
                     RQVYYRDKGISHAKAGRYSQAVMLLEQVYDADAFDVDVALHLGIAYVKTGAVDRGTEL
                     LERSLADAPDNVKVATVLGLTYVQVQKYDLAVPLLIKVAEANPINFNVRFRLGVALDN
                     LGRFDEAIDSFKIALGLRPNEGKVHRAIAFSYEQMGRHEEALPHFKKANELDEGASV"
BASE COUNT          176 a          251 c          266 g          182 t
ORIGIN      
        1 cgccgacgat cacgcgtgat atggtcgccc ggagcgtcaa tcctcacgaa gtgcgcgggc
       61 cgtgngaagc ctgccacgtc ataaagtgat cagagccacn tgattaggat tttggagaac
      121 actatgtcta gcaagccgtc ggatattctt gacgaggtca ctctttacgc tcactacggc
      181 ctttcggtgg cgaagaagct cggaatgaac atggtcgatg cgttccgtgc ggccttttcc
      241 gtcaacgacg acatccgcca ggtgtattac cgcgacaagg gcatctccca cgccaaggcc
      301 gggcgctatt cccaggccgt catgctgctg gagcaggtct acgacgccga tgccttcgat
      361 gtggatgtgg ctctgcacct gggaatcgcc tatgtgaaga ccggcgccgt cgatcgcggc
      421 accgaactac tcgaacgttc cttggccgat gcgcccgaca acgtgaaggt ggcgaccgtt
      481 ctcggcctga cctatgtgca ggtgcaaaag tacgatctgg ccgttccgct gctgatcaag
      541 gtggccgagg ccaatcccat caatttcaac gtccggttcc gtctgggcgt ggcgctggac
      601 aacctcggcc gtttcgacga agccatcgac agcttcaaga tcgcgctggg cctgcgtccc
      661 aatgaaggca aggtgcatcg cgccatcgcc ttcagctatg agcagatggg ccggcacgag
      721 gaagccttgc cgcatttcaa gaaggccaat gaacttgacg aaggggcctc ggtctgaggc
      781 cgtatgtggg gcgtttcctt catacgacga gcttagagag gcggatatgg cattaggcga
      841 cgcgaatgtt ggttcggccc ctggggtcga cttcagt
//