LOCUS       AY141210                 426 bp    mRNA    linear   PLN 02-JUL-2003
DEFINITION  Arabidopsis thaliana MADS-box protein AGL27-III mRNA, complete cds.
ACCESSION   AY141210
VERSION     AY141210.1
KEYWORDS    .
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 426)
  AUTHORS   Parenicova,L., de Folter,S., Kieffer,M., Horner,D.S., Favalli,C.,
            Busscher,J., Cook,H.E., Ingram,R.M., Kater,M.M., Davies,B.,
            Angenent,G.C. and Colombo,L.
  TITLE     Molecular and phylogenetic analyses of the complete MADS-box
            transcription factor family in Arabidopsis: new openings to the
            MADS world
  JOURNAL   Plant Cell 15 (7), 1538-1551 (2003)
   PUBMED   12837945
REFERENCE   2  (bases 1 to 426)
  AUTHORS   Folter,S. de, Busscher-Lange,J. and Angenent,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (14-AUG-2002) Plant Development and Reproduction, Plant
            Research International, Bornsesteeg 65, Wageningen 6708 PD, The
            Netherlands
FEATURES             Location/Qualifiers
     source          1..426
                     /organism="Arabidopsis thaliana"
                     /mol_type="mRNA"
                     /db_xref="taxon:3702"
                     /tissue_type="rosette leaves"
                     /ecotype="Columbia"
     CDS             1..426
                     /codon_start=1
                     /product="MADS-box protein AGL27-III"
                     /protein_id="AAN52774.1"
                     /translation="MHFCFISSISKIIDRYEIQHADELRALDLEEKIQNYLPHKELLE
                     TVQRLAVRHIFLPSSSDKKNVFFLLSTCEYSKLEEPNVDNVSVDSLISLEEQLETALS
                     VSRARKAELMMEYIESLKEKVSALVFIFDKGHILGYDDS"
BASE COUNT          132 a           72 c           80 g          142 t
ORIGIN      
        1 atgcattttt gttttatctc cagcatttcc aagatcattg atcgttatga aatacaacat
       61 gctgatgaac ttagagcctt agatcttgaa gaaaaaattc agaattatct tccacacaag
      121 gagttactag aaacagtcca aaggttagca gtacgacaca tttttctccc ctcttcttct
      181 gataaaaaaa atgttttttt tcttttgtct acttgtgaat acagcaagct tgaagaacca
      241 aatgtcgata atgtaagtgt agattctcta atttctctgg aggaacaact tgagactgct
      301 ctgtccgtaa gtagagctag gaaggcagaa ctgatgatgg agtatatcga gtcccttaaa
      361 gaaaaggtta gtgctttggt ttttattttc gataaaggcc atattctagg ctatgatgat
      421 tcttga
//